KEGG   Oryzias latipes (Japanese medaka): 101165110
Entry
101165110         CDS       T02443                                 

Definition
(RefSeq) cytochrome c iso-1/iso-2
  KO
K08738  cytochrome c
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101165110
   04115 p53 signaling pathway
    101165110
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101165110
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101165110
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 101165110
NCBI-ProteinID: XP_004081820
UniProt: A0A3P9I1L8 A0A3B3IP96
LinkDB
Position
21
AA seq 105 aa
MTGDIEKGKKAFVQKCAQCHTVEQGGKHKVGPNLWGLFGRQTGQAPGYSYTDANKSKGII
WNEETLMIYLENPKKYIPGTKMIFAGIKKKNERVDLIAYLKSATS
NT seq 318 nt   +upstreamnt  +downstreamnt
atgactggagacattgaaaagggcaagaaggcatttgtccagaagtgtgcccagtgtcat
actgttgaacagggtggaaagcacaaggtgggacccaacctttggggcctctttgggcgt
cagactggccaggctcctggctactcctatacagatgccaacaaaagcaagggcattatc
tggaatgaggaaaccttgatgatttatttggagaacccgaagaaatacatcccagggaca
aagatgatcttcgctggcatcaaaaagaagaatgagcgagttgacctgatcgcatacctc
aaatctgcaacttcatag

KEGG   Oryzias latipes (Japanese medaka): 101171965
Entry
101171965         CDS       T02443                                 

Definition
(RefSeq) cytochrome c iso-1/iso-2
  KO
K08738  cytochrome c
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101171965
   04115 p53 signaling pathway
    101171965
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101171965
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101171965
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 101171965
NCBI-ProteinID: XP_004084738
UniProt: H2MWH8
LinkDB
Position
15
AA seq 104 aa
MGDVDKGKKVFVQKCAQCHTVEEGGKHKVGPNLWGLFGRKTGQAPGYSYTDANKSKGITW
NEDTLMVYLENPKKYIPGTKMIFAGIKKKGERQDLISYLKSATS
NT seq 315 nt   +upstreamnt  +downstreamnt
atgggtgacgtggacaagggaaagaaggtgtttgtccagaaatgtgcacagtgccacacc
gtagaggaggggggcaagcacaaggtgggccccaacctatggggtctgtttgggcgcaaa
accgggcaggcgcctggttactcctacacagacgccaacaagagcaaaggcatcacctgg
aacgaggacaccctgatggtgtacctggagaaccccaagaagtacattcctggaactaag
atgatctttgcaggcatcaagaagaagggcgagcgccaggacctcatctcctacctgaag
tcagccacttcatga

DBGET integrated database retrieval system