KEGG   Oryzias latipes (Japanese medaka): 101165302Help
Entry
101165302         CDS       T02443                                 

Gene name
neil1
Definition
(RefSeq) endonuclease 8-like 1 isoform X1
  KO
K10567  endonuclease VIII-like 1 [EC:3.2.2.- 4.2.99.18]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    101165302 (neil1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101165302 (neil1)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     101165302 (neil1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     101165302 (neil1)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     101165302 (neil1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neil1-DNA_bind Fapy_DNA_glyco H2TH
Motif
Other DBs
NCBI-GeneID: 101165302
NCBI-ProteinID: XP_004069676
UniProt: H2LSQ7
LinkDB All DBs
Position
6
AA seq 413 aa AA seqDB search
MPEGPELHLASLYVNRMCDGVVFAGAVRKSEVSKNPEVAFTCEAYRITAASRGKEVKLTL
TPIKSDDPDRRGKAAQPMDIVFRFGMSGYFRFTSEDEVPKHAHLRFYTKEKPCKVLSFVD
ARRFGSWQPNGTWQPDRGPCIMFEYQHFRENVLSNLSDRAFDRPICEVLLNQKYFNGIGN
YLRAEILYRLNIPPFVPARGVLESLGADDLFENKKPLKDVATKRAKKKEVKQEAGDLLRL
CHTVPLEVISLGGKGYDPEKSDYSAFQAWLQCYYVDGMKSIRDHNGRTMWFKGDPGPMAP
KNSKSPKAKKRIKNEDDHDYTNKKKKIRSQSKSATKKKVVKEEGETETSKVNEAKTKEAI
VARAKTGKTQETSKPQIGTRSSARQRKANTTEGAGDQKKLNGKGSRKSRKQEN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagggaccagagttgcacttggccagcctgtatgtgaacaggatgtgtgatgga
gtggtatttgctggtgcagtcagaaagtctgaagtcagcaaaaacccagaggtggccttc
acctgcgaggcctatcgcataacagccgcttcaaggggaaaggaagtgaagctaacgctg
acgcccatcaagagtgacgatcccgatcgtaggggaaaagcagctcagcccatggacata
gtctttcgcttcggaatgtcaggttatttccgtttcacgagcgaggacgaagtgcccaag
catgcccacctgcggttttacaccaaagaaaaaccctgcaaagtgcttagctttgtggat
gcacgcaggtttggaagctggcagcccaatgggacgtggcagcctgacagagggccctgt
atcatgtttgagtatcaacatttcagggagaatgttttgtcaaatctgtctgatcgggct
tttgaccggccgatttgtgaagtcctgctgaatcaaaagtactttaatggcatcggaaac
tacctcagggctgaaatcctttacaggttaaacatcccacccttcgtgccggcccgggga
gtactggagagccttggtgcagacgatttgtttgagaataagaagcctttgaaagatgta
gccacaaagagagcgaaaaagaaagaagtgaagcaagaggcaggtgacctcctcaggctt
tgtcacacagttcctttggaagtcatcagtctaggtgggaagggctatgaccctgagaaa
tcagactactcagcctttcaggcgtggctgcagtgttattacgttgatggaatgaaatct
attcgggaccacaacggcagaaccatgtggtttaaaggagatcctggtcccatggcaccc
aaaaattcaaaatcaccaaaggctaaaaagagaattaagaacgaggacgaccatgattac
acgaacaagaaaaagaagatcagaagtcagtctaaaagtgcaacaaagaaaaaggtggtc
aaagaggagggggagaccgaaacatcgaaggtaaatgaagcaaagacaaaggaagctatt
gttgccagagcaaagacaggaaagacccaggaaacatcaaaaccacagatcggaacaaga
tcgagtgcacgtcagaggaaggccaacacaacagaaggagcgggagaccaaaagaaacta
aatggaaaaggatcaaggaagagcagaaaacaggaaaactaa

DBGET integrated database retrieval system