KEGG   Oryzias latipes (Japanese medaka): 101165555Help
Entry
101165555         CDS       T02443                                 

Definition
(RefSeq) uncharacterized protein LOC101165555
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101165555
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ola03036]
    101165555
Enzymes [BR:ola01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101165555
Chromosome and associated proteins [BR:ola03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101165555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 101165555
NCBI-ProteinID: XP_004071279
UniProt: A0A3B3I4W8
LinkDB All DBs
Position
8
AA seq 1938 aa AA seqDB search
MDGCTRMSVKELCETDDLATSLVLDPLLGFSTHKMNISPQPEIRRWGNLKETLLRFQRTH
DFNAAFEALTVGEPAGDFFGALGSHRQELLRQHVYRYLSAFLLDSGIKIEPCDRYSSETN
GAKITSTRHWFIGERVEVLLGCIAELSPADSCFVTAGVNDFSVMYSTRKRCAQLWLGPAA
FLNHDCKPNCKFVPCEKNVACVEVIRPISPGEEITCYYGASFFGEGNEMCECCTCERNGE
GHFKHRGKQPECEETKEPGGQKYRLRERYLRHQRERGHFAARPVTPGLHSGIFKAIPSRN
SFTQQMRRNALKNRKLTQTKTWREKQRLSGRRVKRCQTVPPLSNVTLKNLSIRVRRHTVD
FLLHCKNPKSKERALLQELEDMNLKGHSTGEQNGSRALKLKPLTLNSSRPSQQKTREALN
RAGLDRKPVKVAGKPTPPVRSSSRAKSTVEPTTQTQTMNADKSSCEVTQEEKKTAIAEGQ
SNKSSSSESCTITADQTLSAEHKTVRSSSLMEVCKSITVGSKKAADNQTVSLKQYVTVNL
TRLSVPLTPLAAADAKQTAVVSGSRKQRPRPRSRKRSSRSDRCAGEGNGEKNATFIQTKD
RLNLQETEVCHKNRTNTVTKPLKQKSQQDIEKEETLPPRERRNDLANVVQCKDECDVKAK
ETVFEDNGGGNKIKSVCKQIPKVSEQIKQNFKEQPVCPNKEVVIKRAKVLLSDILGKGQS
LKERVLLESLRSSVSTETLRVKEELEETEINGSRCLRSLRRKTASGQKRNLRPAKTKADS
KQSKGEAPASAKAAMNQERFQPQCPQRQDDPVTSCPSPLPHRSPSLAKAATNLKTDTNPQ
LHTQSNIPLKKRTFRSSVEVDTEQSRHPACEQIPPKIPDLDLAPKQKDVVGSQERDGKVR
CRAEGPARKKMKPAKSRRVLRSRANRVQRRHLARKAKRGPSEKRKEPAAAQERQTDNTKE
ADAAETQQEGSESQGNKQVDEHSSSEDTKPTLDFKIRLKRRRGRVWEMQSENMPLKAEKG
DDVVPCDPFKAIMDSVSILNMEMEAAQAHVHASKKSRNRLHRLKRRAEKMSGKQVSGSAA
ARQAPARSPERTGPRDSVNGRVANKETFAGSQQLSGSTENQNGGGVASPLMGRETKTEDR
FLNNCCLFESGLEPKLESKLDDISLPVIKLRRKVEDIWEVDSKDGLLQPDRESELCIKRE
IRGLGSDKKPKGCTDCSAFKEEKLNSIAAPLKTEPPSFTLSLSPLSLSSPVSESRTEVPP
SAAERTADRSEMNSGGRKPRHKMERPRRCAPVEAPPTCLSHTLQQIDNSLSRLSEGLCSS
QTLEKPADGSSDSNSVVQPSSQSPLFAAAENMLSAEPSFTNCCEDILDFQCLNFEGYYQP
QSMLPSSPSDLCSLDPPTDPFSSPLSHSPADTWTTETPYLGPPSPGNNFTSEDLQFFPGL
ISSKSEAAALECEAREAAKDRNPLNPTFGFVGNSDLTTKDRIISKNLATRSREDLKTQSV
SVAGKPRLFGSTPSSAMPQNPVTLTQPSISIRPSTSQCKSQSNLKSHGPFHRMTIPGKPQ
SFPTGQSSTARASPQTSNRFLSPQLLSVKNPNPPESPYSFQEKSSTVIHRVLKFQGGNQT
QNLYSAPSKDTMAAADPSVTARTHAAKSGVGEKPHEAYGIGGHQKSINSLHGFGSSNNHS
RPSLHFNKSSSSISQPVNARKMSSDKQDEANMTYKNFSAMPRSFVFPCKDSYASLHEKSL
KLDKPSMPTSEKNQPCYTQQDPFDYSFGSSLSSMTQHSSPQVIQSTPPSTPAPANKSQSS
TSSSFPYGYQGPPYVLNFSGDHSLTLGLRDGAEGYPGFGSTNYTYHCLMEPSGTQGRLVL
EPCGPQLSNAANLGIFSGLKSQDDHCRKDLQQCQPGENQATSHYGPVLTSHSMGATKPKR
VRLVVTDGTVDLDLQYSD
NT seq 5817 nt NT seq  +upstreamnt  +downstreamnt
atggacgggtgcactagaatgagtgtgaaggaactgtgtgagaccgatgacctggccacc
agtttggtgctggaccctcttctgggcttcagcacccacaaaatgaacatcagtccccaa
ccagagatccggcgatgggggaacctgaaagaaaccttgttgcggttccagcgcacgcac
gacttcaacgctgcgttcgaggccctgacggtgggagaaccggcgggcgacttcttcggt
gctttgggaagccatcgacaggagctgctgagacaacatgtctaccgctacctcagtgcc
ttcctgctggatagtggcatcaagatcgagccctgcgacagatactcctcagagacgaac
ggtgcaaagataacatccaccaggcactggtttataggagaacgcgtggaggtcctgttg
ggctgcattgcagagctgagtccggcggacagttgctttgtgacagcaggggtcaatgac
ttcagcgtcatgtactccacgcgcaaacgctgcgctcagctgtggctcgggcctgcagct
ttccttaaccacgactgcaaaccaaactgcaagttcgtcccctgtgagaaaaacgtcgcc
tgcgtggaggtgattcgacccatatcgcctggggaggagatcacgtgttactacggcgcc
agcttttttggcgaaggcaacgaaatgtgtgaatgctgcacctgtgaaaggaacggggag
ggtcacttcaaacacagaggaaaacagcccgaatgcgaggagacaaaggagcccgggggc
caaaagtaccgcctgagggagcgatacctccgtcatcaaagggagagaggccactttgct
gcgaggccagtcacacctggattacactctggcatcttcaaagccatcccgtcgaggaac
tccttcacccagcagatgaggagaaatgccctgaagaacagaaaactgacccaaaccaag
acgtggagagagaagcagagactttctggaaggcgggtcaaacggtgtcagacggtcccg
cctctgtcgaacgtcactctgaagaacctcagtatccgagtccggcgccacacggtggat
tttttacttcactgcaagaatcccaaaagcaaagaaagggctttgcttcaggaactggag
gacatgaacctcaaaggtcactccaccggcgagcagaatggcagcagggcgctgaagtta
aaacctctgaccctcaactcttccagaccatcccagcagaagaccagagaggccctgaac
agagcaggtctggacaggaagcccgtcaaagtggcgggcaagcccactcctcccgtcagg
tcctcttccagagcaaaaagtacggttgagcccaccacacaaactcagactatgaatgct
gacaaatccagctgtgaagttacacaggaagagaagaagaccgcaatcgcagaaggtcaa
agcaacaagagcagcagttctgagtcctgcaccatcaccgcggaccaaactctgtctgcc
gagcacaaaaccgtcaggtcctcctccctgatggaggtctgtaaaagcatcacagttggg
tcaaaaaaggcagcagacaatcaaacggtgtctctgaagcaatacgtcacggtcaacctg
accaggttatcggtgccgctgactccactggctgctgctgacgctaaacaaacggctgtg
gtctcaggttcaaggaaacagcgtcccagaccgcggagcagaaagcggagttccaggtct
gaccgctgcgcgggtgaagggaacggagagaagaacgcaacgtttatccagaccaaagac
agactgaacttacaggaaacggaggtttgtcacaaaaacaggaccaatacggttacaaaa
cctttgaaacaaaagagccagcaggacatcgagaaagaggaaactctaccgccgagagaa
agaagaaacgatctggcaaatgttgtccaatgtaaagatgaatgcgacgtgaaagcaaaa
gagacggtttttgaagacaatggtggcggaaataagatcaaaagtgtttgtaagcagatt
ccgaaggtgtcggaacaaatcaagcagaacttcaaggagcagccagtttgtccaaataag
gaagttgtaataaaacgggcaaaagttttactgtcagatattttagggaaaggtcagtcg
ctaaaagagagagtacttttggagagtttaaggtcctcggtctccacagagacgctaaga
gtcaaggaagagctagaagagacggaaataaacggcagcaggtgtcttcgatccttaaga
aggaagactgcgagcggtcaaaagagaaatcttagacctgcaaaaacaaaagctgacagc
aaacaaagcaagggtgaagcgccagcttcagctaaagcagcgatgaaccaggaacgtttc
cagcctcagtgtccacagaggcaggacgacccagtgacctcctgtcccagcccgctacct
cacagatcaccaagtttagcaaaagctgcaaccaacctaaagacagacactaacccgcag
ctgcacacgcagtccaacatacctctgaagaaacgcacgtttcgcagttccgtggaagtg
gacacggagcaaagtcgccatcctgcctgtgagcaaattccccccaaaattcctgacctg
gacttagctccaaagcagaaggacgttgtgggttcgcaggagagggacggcaaagtcagg
tgcagagcagaaggcccggcaagaaaaaagatgaaacccgccaaaagtagacgagtgctt
aggtccagagcaaaccgagtgcagcgaagacatctagcgaggaaagcgaaaagaggtcca
tcggagaagcgaaaggagcccgccgctgctcaggaacgacagaccgacaacacaaaggag
gcggacgcagctgaaacccagcaggaaggaagtgaaagtcaagggaacaagcaggtggat
gaacacagtagttctgaagacaccaaaccgaccctggattttaagatccgcctgaagaga
agaagaggccgagtgtgggaaatgcagagcgaaaacatgccgctaaaggcggagaaagga
gacgacgtggtgccgtgtgatcctttcaaagccatcatggattctgtgtccattctgaac
atggagatggaggcagctcaggctcatgtgcacgccagcaagaagtcacggaaccggttg
caccgcttgaaaaggagggcggagaaaatgagcggaaaacaagtttccggttcagctgca
gctcgccaagcgcctgccagatcccctgaacgcaccgggccgagagactctgtcaacgga
agagtggccaataaggagacgttcgcgggatcgcagcagctttcaggatcaacagagaac
caaaatggtggcggtgttgcatccccattgatggggcgtgaaacaaaaacggaggatcga
tttctaaataattgctgcctgtttgaaagtgggttggaaccaaagctggagtccaaatta
gacgatatttcattaccagtaatcaaattacggaggaaagtggaggatatttgggaggtg
gacagcaaggacggtctcctgcagcctgaccgtgagtcagaactctgcattaagagggag
atcaggggtcttgggtcagacaaaaagcctaaaggatgcacggattgcagtgctttcaaa
gaggagaaactgaacagcatcgcagccccgctgaaaacagaaccgccctccttcactctg
tctctgtcaccattatcgctttcgtcgccggtcagtgaaagtagaacggaagtcccaccc
tctgctgcagagagaaccgccgataggtctgagatgaacagcggaggcaggaaacccagg
cacaaaatggagagaccgcgcaggtgtgcgcctgtggaagccccgcccacctgcctgagt
cacacgctccagcaaatcgacaacagcctgtccaggctctccgagggcttgtgttcctct
cagacgttggagaagccggcggacggctcctcggattccaactctgtggtccagccgtcg
tcgcagtctcctctgttcgcggctgcagaaaacatgctttctgctgagcccagcttcacc
aactgctgtgaggacatcctagactttcagtgtctgaactttgaggggtattatcagcca
cagagcatgctgccgtcgtctccgtcagacctgtgttccctggatccacccaccgatccc
tttagcagcccgctctcccacagcccggctgacacatggaccacagaaacgccgtacctc
ggcccgcccagtccaggaaataacttcactagtgaggatttgcagttttttccgggcctc
atttcttctaaaagtgaagctgccgctttggaatgtgaagccagagaggcagctaaagac
agaaaccctctcaatcccacttttggcttcgtgggaaactccgacttgaccacaaaggat
cgaattattagcaaaaaccttgcaacgagatctagagaggacctcaaaacacagtctgtg
tctgtggccggcaagcctcgtttgtttggttccaccccgtcttctgctatgcctcaaaat
cctgttactttgacccaaccatccatcagcatccggcccagcaccagccagtgtaaaagc
cagtccaacctcaaaagccacgggcctttccatcgcatgaccattccgggaaaaccccag
tcgttcccaaccggtcagtcgagcacagctagagcttcacctcaaacgtccaacagattc
ctcagtcctcaacttttgtctgtgaaaaaccccaatcctcccgaaagtccatacagtttc
caggagaagtcctccacggttatccacagggttttgaagtttcagggggggaaccagacg
cagaacttatacagcgcacctagcaaagacactatggctgctgctgacccgtctgtcacg
gccaggacacatgctgctaaatcaggtgttggcgagaagccccatgaggcctacggcatt
ggtggtcatcaaaagagcatcaactctcttcacgggttcggttcttccaacaatcacagc
aggcccagccttcatttcaacaaaagcagttcttccatttcacaacctgtcaacgcaagg
aagatgtcttcggacaaacaagacgaagccaacatgacgtacaaaaacttctctgcgatg
ccgagatccttcgtgtttccctgcaaagacagctacgcctcactgcacgagaagagcttg
aagctggataagcccagcatgccaacctctgagaagaaccagccgtgttacacccaacag
gacccctttgattacagctttgggtcgtcgctttcgtccatgactcagcacagcagcccc
caggtgatccagagcacacccccttccacgccagcaccagcaaacaagagccagtcctca
acgtcctcctctttcccttacggctaccaaggtcctccgtacgtgctgaacttcagcgga
gaccactcactgactctgggtctcagggacggggctgaaggctatccgggcttcggctcc
acaaactacacctaccactgcctgatggagccttcaggaactcaagggcggctggttctg
gagccgtgcggaccccagctctccaacgcagctaatttaggtattttttcaggtctcaag
agtcaagatgaccactgcaggaaagacctgcagcagtgccagcccggagaaaaccaggcc
acgtcacactacggtccagtcctaacatcccactctatgggcgccacaaaacccaagagg
gtgaggctggtggtgacggacggtacggtcgacctggacctccagtactccgactga

DBGET integrated database retrieval system