KEGG   Oryzias latipes (Japanese medaka): 101165741Help
Entry
101165741         CDS       T02443                                 

Gene name
hsd17b8
Definition
(RefSeq) estradiol 17-beta-dehydrogenase 8
  KO
K13370  17beta-estradiol 17-dehydrogenase / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) / 3-oxoacyl-[acyl-carrier protein] reductase alpha subunit [EC:1.1.1.62 1.1.1.239]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00061  Fatty acid biosynthesis
ola00140  Steroid hormone biosynthesis
ola01100  Metabolic pathways
ola01212  Fatty acid metabolism
Module
ola_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101165741 (hsd17b8)
   00140 Steroid hormone biosynthesis
    101165741 (hsd17b8)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     101165741 (hsd17b8)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     101165741 (hsd17b8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3Beta_HSD Epimerase Polysacc_synt_2 3HCDH_N 2-Hacid_dh_C F420_oxidored TrkA_N Mannitol_dh GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 101165741
NCBI-ProteinID: XP_004074105
UniProt: H2LQ79 A0A3P9JPW8
LinkDB All DBs
Position
11
AA seq 256 aa AA seqDB search
MAASTRLISRLTLVTGGGSGIGRAVCQRLASEGASVVVADINQESADETFSSLPDNLRGQ
VHMATVVDVSLKDSVKKLVTNIQTRYFQPPSVCVNTAGITQDEFLLNMEEEQFDRVIQVN
LKGSFLVTQAVAQALVACGASKGSIITVGSIVGKVGNLGQANYAASKAGVEGLTRTAAKE
LSRFGIRCNCVLPGFITTPMTDKVPEKVISKITTLVPLGRMGEPAEVADACAFLASDDSR
YITGTSIEVTGGLFMG
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttccacccggctcatttcaaggttgacactggtcactggaggaggcagtgga
attggacgggcggtgtgccagcgtttggcctctgagggcgcctccgttgtggttgcagac
atcaaccaagagtcagcagatgagacgtttagcagtctcccggacaacctcagaggtcag
gtccacatggcgactgtggtggacgtgtcgttaaaagacagcgtgaagaagctggtgacc
aacatacagacccgttacttccagcctccctcagtatgtgtgaacacagcaggcatcact
caggacgaattcctgctcaacatggaggaggaacagtttgacagagtcattcaggtcaac
ctgaagggttcattcttggtcactcaggctgtcgctcaggctctggttgcatgtggagct
tccaaaggatctatcattacagttggaagcattgtgggaaaagtggggaacctcggacag
gcaaactatgccgcctccaaagctggagttgagggtttgacgcgcacggctgccaaggag
ctcagcagatttgggattcggtgtaactgtgtgttgccaggattcataaccaccccgatg
acagataaagtgccagagaaagttatcagcaagataacaaccttggtgcctctgggaaga
atgggagagcctgcagaggttgctgatgcctgtgccttcctagcttctgacgactctcgc
tacatcacagggaccagcattgaagtaacaggtggactttttatgggctga

DBGET integrated database retrieval system