KEGG   Oryzias latipes (Japanese medaka): 101165981
Entry
101165981         CDS       T02443                                 

Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101165981
   04115 p53 signaling pathway
    101165981
   04218 Cellular senescence
    101165981
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101165981
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101165981
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101165981
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2
Other DBs
NCBI-GeneID: 101165981
NCBI-ProteinID: XP_023813163
LinkDB
Position
8
AA seq 298 aa
MSTEQLRYELLAEVGEGSFGRVYKAREIGEKQRLLAVKKLNFSLDSAKAGIPPFMIREVA
LLKKMGYFNHPNIVKLLDASAVPVGSTLDLTLVLEYIDQDLSTYLSKVPAPGLSRNCIKD
VMQQLLRGLDFLHTNLVLHRDLKPENVLVSSRGEIKIADFGLARIHTFNIALTPGVVTLW
YRAPEVLLNSVYMSSVDMWSAGCIFAELFLLRPLFKGFTEVQQLQKIFEVIGLPSEEEWP
QDSPISYSGSWGAPGSCTQLLPNLDPDENDLLSKCLVFSPSRRVSAAKALAHHFFVKH
NT seq 897 nt   +upstreamnt  +downstreamnt
atgagcaccgagcagctgcggtacgagctcctggcggaggtcggagaaggctccttcggg
agggtttacaaagccagagagatcggggagaaacagcgcctcctggcggtgaagaagctg
aactttagcttggactcggcaaaagccggaatccctcccttcatgatccgggaggtggcg
ctgttgaaaaagatgggctacttcaaccatcccaacatagtcaaacttttagatgcatct
gctgtcccggtgggctccactctggacctcactctcgtgctggagtacattgatcaggac
ctgtccacctacctgtcaaaggttcccgctcctggtttgagccgtaactgcataaaggat
gtgatgcagcagctgctgcgggggctggacttcctgcacacaaaccttgttctgcaccgg
gacttgaaaccagagaacgtcctggtcagcagccgtggagaaatcaagatcgcagacttt
ggtctggcgaggatccacacctttaacatcgctctcactccgggggtggtgactctgtgg
taccgagctccagaggtgctgctcaactctgtttacatgtcctctgtggacatgtggagc
gctggctgcatctttgctgagctcttcctgctgagaccgttgtttaagggcttcacagag
gtgcagcagctgcagaaaatatttgaggtgatcggtttgcccagcgaggaggagtggcct
caggacagcccgatctcgtactcagggagctggggggctcccggctcctgcacccagctg
ctgcccaacctggacccagacgagaacgacctgctttctaaatgtttggtattcagcccg
agtcgccgcgtctccgccgccaaagccctggctcatcatttctttgtgaagcactga

KEGG   Oryzias latipes (Japanese medaka): 101168879
Entry
101168879         CDS       T02443                                 

Gene name
cdk6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101168879 (cdk6)
   04115 p53 signaling pathway
    101168879 (cdk6)
   04218 Cellular senescence
    101168879 (cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101168879 (cdk6)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101168879 (cdk6)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101168879 (cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2
Other DBs
NCBI-GeneID: 101168879
NCBI-ProteinID: XP_004074048
UniProt: H2LGM4
LinkDB
Position
11
AA seq 325 aa
MDKECIGTQYEPVAEIGEGAYGKVYKARDLKNEGRFVALKRVRVQTEEEGMPLSTIREVA
VLRQLEAFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKVPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKIFDVVGVPSAEDW
PQEVALPQSAFTPRPPKPIEDLVPDIDEQGQALLMQFLAFNPSRRISAFTALSHPYFQSL
DSHSRSVYAAQPIPSNNPTMEERTA
NT seq 978 nt   +upstreamnt  +downstreamnt
atggacaaagaatgtattggtacccagtatgagcctgtggccgagattggagaaggagcc
tatggaaaagtgtacaaggccagggatttgaagaacgagggacgctttgtagccctgaaa
agagttcgagtccagacggaggaagagggaatgccgctctccaccatccgcgaggtggcg
gtactgaggcagctggaggcctttgagcaccccaatgttgtgaggttgtttgatgtgtgc
acagtgtctcgtacagaccgggaaaccaaactaacgctcgtctttgaacatgtggaccag
gacctgaccacatatctggagaaggtcccggatcctggagttccgcctgagaccatcaag
gatatgatgtaccagctgctccagggactggacttcctgcactcgcaccgtgtggttcac
cgtgacctgaagccccaaaacatcctggtcactagcggaggacagatcaaactggcggac
tttgggctagctcgcatctacagcttccagatggctctgacatctgtggtggtgactctc
tggtaccgagccccagaggtgctgctccagtccagttatgctacaccggtggacttgtgg
agtgttggctgcatcttcgcagagatgttcaggagaaggccgctatttcgaggaaactca
gatgttgatcagctgggaaagatttttgacgttgttggggtgccgtcagcagaagactgg
ccccaggaagtcgccctccctcagagtgccttcacccctcggcccccaaaaccgatagaa
gacctggttccagacatagacgagcaaggacaagctctattgatgcaatttcttgcgttc
aacccctccaggagaatatcggccttcacagccctaagtcacccctactttcagagcctg
gacagccacagcagaagcgtgtacgcagcgcagcccatccccagcaacaaccccaccatg
gaggaaaggacggcctga

KEGG   Oryzias latipes (Japanese medaka): 101172808
Entry
101172808         CDS       T02443                                 

Gene name
cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101172808 (cdk4)
   04115 p53 signaling pathway
    101172808 (cdk4)
   04218 Cellular senescence
    101172808 (cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101172808 (cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101172808 (cdk4)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     101172808 (cdk4)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CMGC group
  CDK family
   101172808 (cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like POT1PC
Other DBs
NCBI-GeneID: 101172808
NCBI-ProteinID: XP_011473751
UniProt: H2MK52 A0A3P9MGH8
LinkDB
Position
5
AA seq 320 aa
MAQCTGLQYEPVAEIGGGAYGTVYKARDIESGKFVALKNVRVQTDQNGLPVSTVREVALL
KRLEQFDHPNVVRLMDVCATKRSDQETKVTLVFEHVDQDLKTYLERAPAPGLSPERVKDL
MKQLLSGLSFLHSNRVMHRDLKPENILVTSQGQVKLADFGLARIYSCHMALTPVVVTLWY
RPPEVLLQSSYATPVDIWSTGCIFAEMFRRKPLFCGESEMDQLGKIFEVLGLPPEEEWPT
DVTVSRKNFPLLHARPITDFVPEINEEGAQLLLQMLTFDPLKRVSAVKALEHPYFQDEEP
ATQTESLNQGVKSAAGGICV
NT seq 963 nt   +upstreamnt  +downstreamnt
atggcgcagtgcaccggtctgcagtacgagccggtggcagagatcggtggtggcgcatac
gggaccgtctacaaggctcgcgacatcgagagtggcaagttcgtcgccctgaagaacgtg
cgcgtccagactgaccaaaatggcctcccggtgtccacggtcagagaggtggcgctgttg
aagcgcctagagcagtttgaccaccccaatgtggtcaggcttatggatgtgtgtgccacc
aagagatccgaccaggaaaccaaagtcactctggtgtttgagcatgtggaccaagacctg
aaaacgtatctagagagagctccagctccagggttgtcaccagagcgcgtgaaagacttg
atgaagcagttgctgtctggcctctccttcctccactcaaaccgcgtgatgcacagagac
ctgaaacccgagaacattctggtgaccagccagggccaggtcaaactagcagactttggc
ttagcgaggatatacagctgccacatggccctcactcctgtggtggtgacgttgtggtat
cgaccccccgaagttctgctgcagtccagctacgccactcctgtggacatttggagcacg
ggctgcatttttgctgaaatgtttagacgcaaacctttgttctgcggagagtcagagatg
gaccaacttggcaaaatcttcgaagttcttggcttacccccagaggaggagtggcccact
gatgttaccgtgtccagaaaaaacttcccccttctccatgctcgcccaataacagatttt
gttccagagataaatgaggagggggcccaactattgctgcaaatgttgactttcgaccct
ttgaaacgagtttcggccgtgaaagctctcgagcatccgtacttccaggacgaggagcca
gcgactcagacagaaagcttgaatcagggagtaaaaagcgccgcaggaggcatctgtgtt
tga

DBGET integrated database retrieval system