KEGG   Oryzias latipes (Japanese medaka): 101166216
Entry
101166216         CDS       T02443                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101166216
   04068 FoxO signaling pathway
    101166216
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101166216
   04115 p53 signaling pathway
    101166216
   04218 Cellular senescence
    101166216
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101166216
NCBI-ProteinID: NP_001265812
UniProt: H2L3L8
LinkDB
Position
5
AA seq 156 aa
MAAPKRIPAAPRRPARRNLFGPVDREQLQLEYQAALRKDLDEASLRWGFDFRSDKPLEGS
HFLWESVPGAGVPLLYRCQDAGRVQKTAETRTPPKRRRSELPQREKENIPLTENIFNVEK
TPEKEEKAGMKRKQTNITDFYQAKRRMVWMPRKSGE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggctgctccaaagcggattcccgccgctcccaggaggcccgcgaggcgaaacctgttt
ggcccggtggaccgggagcagcttcagctggagtaccaggccgccctgcggaaagacctg
gacgaagcgtcccttcgctggggcttcgacttccgctccgacaagcccctggagggcagc
cacttcctgtgggagagcgtcccgggggccggagtgccgctgctgtaccgctgtcaggat
gctggacgggtccagaagacggcggagaccaggaccccccccaagagacgaagatctgag
ctgccgcagagggagaaggagaacatcccactgacagagaacatcttcaacgtggagaaa
acaccagagaaggaggagaaggccgggatgaagaggaaacagacaaacatcacagatttc
taccaagctaaacgacgaatggtctggatgccgcggaaatcgggcgagtga

DBGET integrated database retrieval system