KEGG   Oryzias latipes (Japanese medaka): 101166473
Entry
101166473         CDS       T02443                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101166473 (cdkn1b)
   04068 FoxO signaling pathway
    101166473 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101166473 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101166473
NCBI-ProteinID: XP_011474850
LinkDB
Position
6
AA seq 180 aa
MSNVRLSSGSPTLERTEPRVSEHPKPSACRSLFGSVDHEELKRDLNVHLREFEEAASAKW
GFDFATDTPLPNSRLEWELVNARDLPSFYTRLPRRERGVCPGNNNVDLNGNHDCVGTVPS
RSDAQMECTEQCGGLRKRPACHDPSAPSKKSHTSPEEVSCPSLSQSAEHTPRKTSPKRPT
NT seq 543 nt   +upstreamnt  +downstreamnt
atgtctaacgttcgactttcgagcgggagcccgactttggagaggacggagccccgggtg
tcggaacacccgaagccgtcagcctgcaggagcctcttcggctcggtggaccacgaagag
ttaaagagggatttaaatgtacatttgcgggagtttgaagaggctgcctccgccaagtgg
ggcttcgacttcgcgactgacacaccgctgcccaacagcaggctggagtgggagctggtg
aacgccagagacctgccgagtttctacacccgcctgccgcggcgagaacgaggcgtttgc
cccgggaataacaatgtggatctaaacgggaatcatgactgtgtcgggacagttcccagc
cgctctgacgctcagatggagtgcacggagcagtgcggcgggctgaggaagagacctgcg
tgtcacgacccttcggccccaagtaagaagtctcacaccagcccggaggaggttagctgt
ccgagcctgagccagtctgcagaacacacacccagaaagaccagccccaagagaccaacg
tga

DBGET integrated database retrieval system