KEGG   Oryzias latipes (Japanese medaka): 101166855
Entry
101166855         CDS       T02443                                 

Definition
(RefSeq) uncharacterized protein LOC101166855
  KO
K08774  transforming growth factor, alpha
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101166855
   04012 ErbB signaling pathway
    101166855
SSDB
Motif
Pfam: EGF Laminin_EGF V_ATPase_I
Other DBs
NCBI-GeneID: 101166855
NCBI-ProteinID: XP_011492903
LinkDB
Position
5
AA seq 254 aa
MTRIFWDILLLISSLLTFAAMLSSSAVIEASISTKQRLTATPNAVSKSSGTSTDGIAAAT
NIPASNSSLISVEASQMNLTTHLLVYNTITTTSSWTETSAAPPNSSTSTSSANSSRSSAT
NKPDGAVSSHPVKKFVAAAVRSHFDDCPDSHQHFCFHGTCRFLILEDTPACVCHPGFVGL
RCEHADLLAVVATNHRQQTVATVLVLCVVGCVLFMVLCSLLHCWWRQDCQRQSHAHHYVG
EKPGAAGHPSESVV
NT seq 765 nt   +upstreamnt  +downstreamnt
atgactcggattttctgggatattcttcttctgatcagctctcttttgacttttgctgcg
atgctgagctcctcagcagtcattgaagccagtatttccaccaagcagaggctcactgct
actccaaacgctgtcagtaagagctctgggacatccactgacggaattgcagctgcaact
aacatccctgcatctaatagttccctcatatcggttgaagcaagtcagatgaatttaaca
acacatctgttggtttacaacaccatcaccaccaccagcagctggacagagacctctgct
gctcctccaaactcctccaccagcacctcctcagcaaacagcagcagaagcagcgccacc
aacaaaccggatggagccgtcagcagccatcctgtgaagaagtttgtggctgcagctgtt
cggtctcactttgacgactgtcctgactcccatcagcacttctgctttcacggcacgtgt
cgtttcctgatcctggaggacacgcctgcttgtgtgtgtcatccgggtttcgttgggttg
agatgtgagcatgcagacctgctggctgtggtggcgaccaaccaccggcagcagactgtc
gctactgtgctggtgctgtgcgtggttggctgtgttctgttcatggtgctgtgttctctc
ttacactgctggtggaggcaagactgccaaaggcaaagccatgcacatcactatgttgga
gaaaagcctggagcagctggccatccatcagagagcgtggtttga

DBGET integrated database retrieval system