KEGG   Oryzias latipes (Japanese medaka): 101167063
Entry
101167063         CDS       T02443                                 

Gene name
atm
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola03440  Homologous recombination
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    101167063 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101167063 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101167063 (atm)
   04210 Apoptosis
    101167063 (atm)
   04115 p53 signaling pathway
    101167063 (atm)
   04218 Cellular senescence
    101167063 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101167063 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ola03032]
    101167063 (atm)
   03400 DNA repair and recombination proteins [BR:ola03400]
    101167063 (atm)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101167063 (atm)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   101167063 (atm)
DNA replication proteins [BR:ola03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101167063 (atm)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101167063 (atm)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC DUF3310
Other DBs
NCBI-GeneID: 101167063
NCBI-ProteinID: XP_011481164
LinkDB
Position
13
AA seq 3079 aa
MSLALHDLLLCCRGLEHDKATERKKEAENFRRLLRSPAVLQELDCASLAKAKVSKQLTWD
NVFRFLQHYVQKEMESIQSSRSNVTATTLAIRQKKMAEVCSLIKYFIRYANKRGPRLNCS
ELLKHVTEVLQSSHCCTAYGENYSSILLKDILTVRKYWCDISQKQWQNLLDLYCGFFNSS
SRSINRVLLSRVIHTLVRGCCTQTDAFTDALFGFFTKALLNARQEKHLPVLEHLVSALNV
FLRSAAVNCRMRACRLGEELLPSVLYVWADMRPSAPLKEEIVDFLNLQMCVHHPKGAKTH
DTGAHAEDWTRWRGLLYSLYDSLVREISQIGSRGKYATGSRHVAVKDNLIELTADICHQL
FTDDSGSHTLEVTQAPHRATQMGSPSHGAASKRRRIEMGWEVLLERLQPQSDDFDIIPWL
QITSVLTCKYSSTVPRRELVPLLSALHQLLAEQRRGERSLYVLRCLREVALCQARCPHKA
QAHKAELDRLWARIWALGVRGVGSPHTESLSLDLLASIVHGGLVNVDREFWKLFSGSACK
PSKSSALCLTHTILKCPVPKSVTSSSIWDSLGATEGSPSPFLKENLIAWLLLSNQNDETE
DSSRPHPIICRDFPHNLIANILVSLTLKDTRVGLKFLLGTEGVASGSSRDQVASEAKENL
EEIETLYLHFSFNASEIPARANEPAPSADCQFPAVLGLRNKLEQLVLSVADSLLNCYSPD
SPSVPPECLVRCCALLIGVLAGYVSTGCVTQDEACCSRLFTKAKALAQELSGFVSSVKVK
MSDEGAMSSLRSVMKLCTQSASRKPVVHVNAVSSGLFVLALPASLISESAEICKLLLNSW
SKKVDDDEQMEEDWEMTKVQPAGDDHDLFDDGEGSSSFNGANRQKGDGADTSCRPGAKCL
LAEENLSQQDTALLAVLAFLCECGSVPPVHGLLFKPHEVRRRLLLFLEQMDFGKALHLNM
YLVLLKNLPAEDSLSAEEFDLLLRPLADLCGLYRQDQEICVAVLLSLLPSIKSLGRTRPV
LEDMKHVQGCLLQVVSGFCFLSKSGKCSASVRAALVRCLVALLEADPHCNWAILSLRGDE
GEEERLLSSVLPSYLADADHYVRMQVATSVERLFLEMKPEFPKMREMMPLKHQQKAFEHI
YLKAQEGMKLPGNNHLKDEQDEGFNRKATLLKSLSVVLCCSPVCEKQCLFALFQSYKENN
LEEQLIKKVLFSVSKVLGYKSVKSFVTSHLNYLVAEWLAQRQSDDRYTLGSFPYSLLDHD
SVKDFYSSTYQVLIPRLVFLDDFEQVKSIGRCLEKDWRLLLANCFPKIMVNILPYFALPG
QDPQAATQREKAHKVYDLLKDGSCLGKQQIDSLIHSNLADIVVELLMTLCEPSGVEADCG
GLKRFIGELDPAPNPPCFSSDVITATMDYLSKCHSANHRSLVAILSKTPISIQRILLAVC
ERAAETTNGYERHRILLMYHLFVSLLLGEVKDGLGGAWAFVLRDVIYTLIHHINSRPTEY
DEVSQRSLSLCCDLLTSVCQAALQFCDGALDCHLQVIVGTLTAQVTSRPVISKQVLSLLQ
FLIIENQQKLKGAIQSLEPFPNLPDFKELRSVQHKLKYNDGTFTLRQEITHFLSVASCDS
LPLTRLEGLKELTRQLHLNKEQLRDLLKECHADPSDSVLVKLILRLLQLCKLAVNHPGGA
EILEAAGSCLGELGPVDLSTIALLHGRDALYNQAVALFSSTESQSLYIILNCMNEALTQQ
RIEVKKAAAQCVKGILATQAGVDFWDLHKSNRDPMLAYLNPFRTAKNKLSALSVVESLEA
KAKLESQEFWIPQTGSHQTWLKELCTALLDSGGVRSQPLLLSRDLCLVSGDHCQRLLPLI
IHSILLDDPSGSWRELLSSHIQEFFSFCARNAQAASRSATPLIPDNESPAPTQNSCDKSS
LRTMLAAIDYLRHQQRPLDSKRNSGGTVCDSNFWLDLNYLVVAKAAQSCLAHFTALLYTE
IYVDKIKANMEETCRTKSRASRKINFEANSQTLTISSLTEKSVEDVSINLQELLIEVYRS
IGDPDSLYGCGGETMNSPLIRIRTYEHEALWGKALTSYDLHTTLPEVTRQVGIVEGLQNF
GLSNILATYMRGLESEGVEWGAELRELRFQAAWRNSQWDCELAERSEKSVPGFHESIFCS
LQALRDKEFSMFDETLKQARRAEVEELCRDSLEAVSSLYPALRNLQSIKELESFKQLFSR
PFSDLALSNICRQWRQHSHLLADSDFAVVEPILAVRSVAQHALLSKLGNLNSTNLSSALT
DHLMELCCLARKAGNTQLAERAVHQMKIQGGAGSSWQLQEAQVSWAKGEQGLALGQLRQM
IHSLEDKVDFDPDVVPAYTESLRLCGNWLAETCLESPGVILEKYLERAVELVEGERGAQD
SRLQSQQTEAFLSLARFSDAQYQSIDKYMNSSEFENKQALLEKAKEEMNLMRQHKVTSNR
YTIKVQRELELDEKALSNLRTDRQRFLCKAVENYIRCLERGEEHDTWVFRLASLWLENAD
IKVVNNAMKKGVKQIPSYKFLPLMYQLAARMGTKMANGTSEDTGFHDVLHDLICRASLEH
PHHTLFIIFALVNANKDENFGKTRLSMSAPRQLTPFDQERSQVAQKIINVIRKKRAEMIR
GIERLCDAYITLAYMDASRHKTEKKAIPIPADQPIMQIRNLEEVIIPTMEMKVDPSGCYD
NLVTVRSFLPHYHLAGGVNLPKIIDCVGSDGKSRRQLIKGQDDMRQDAVMQQVFSMCSML
LQRNKDTRKRKLNIRRYKVVPFSQRSGVLEWCSGTMPIGEFLTEPNKGAHKRYRPQDWTS
LACRKKMMEAQSLGFDYKLEAYMNVCKNFRPVFRYFCMERFLDPALWMERRLAYTRSVAT
SSIVGYIVGLGDRHIQNILIDEETAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGM
GITGVEGVFRRCCEKTMEVMRSSQEALLTIVEVLLYDPLFDWTMNPLKAFHLQHDEQQDL
NATLGSTMGGVDINDHHKSSDSQSFNKVAERVLLRLQEKLKGVEDGAVLSVGGQVNLLIQ
QAMDPKNLSRLFSGWQAWV
NT seq 9240 nt   +upstreamnt  +downstreamnt
atgagtctggctctacatgatttactgctctgctgcagagggctggaacatgataaagct
actgagagaaagaaagaagctgaaaacttcagacggctccttcgatctcctgcagttttg
caagaactggattgtgcctcattggccaaagccaaagtctccaagcagctcacatgggac
aatgtcttcaggttcctgcagcattatgtccagaaggagatggaaagtattcaatcaagt
agatccaatgtgacggcaaccacgctggctatacggcagaagaagatggctgaagtgtgc
agcttgattaagtactttattcgttatgcaaacaaacgcgggcctcgtctgaattgcagt
gagctgctgaaacacgtgacagaggttctgcagagctcccactgctgcacagcgtacgga
gaaaattacagcagcatccttttaaaggacatcctcaccgtccgcaagtactggtgtgac
atctctcagaagcagtggcagaatctgttggatttgtactgtggcttttttaactcttcc
tccagatccatcaaccgtgtgttgctcagcagagtcatccacacgttggtgcggggctgc
tgcacgcagaccgacgccttcaccgacgctctgttcggctttttcaccaaagctctgctt
aatgccaggcaggagaaacacctgccggtcttggagcatttagtctcagctctgaacgtc
ttcctgaggtcggcggccgtcaactgcaggatgagagcgtgtcgcctgggggaggagctg
ctgccctctgtgctgtatgtgtgggcagatatgaggccaagtgcaccactcaaagaggag
attgtggactttttgaacctccagatgtgtgttcaccaccctaaaggagccaaaacacac
gacacaggtgctcacgctgaagactggacgaggtggcgtggtctgctgtacagcctgtac
gactccttggtcagagagatcagccagataggcagcagagggaagtacgccacagggagc
cgacacgtagctgtcaaagacaatctgatcgagctcacggctgacatctgtcaccagctg
ttcactgatgacagtgggagccatacgttggaggtcacgcaggccccccacagggccacg
cagatgggaagtccctcccacggtgcagccagtaaacgtcggcgcattgaaatgggctgg
gaagtgctcctcgaacgtctgcagcctcaatccgatgactttgacatcatcccttggttg
cagattacctcagtgctcacctgtaagtactcgtctacggtgcccaggcgggagctggtt
ccactgctgtcggcgttgcaccagctcctagcagagcagcgcagaggtgagaggagcctg
tacgtgctgcgctgcctcagggaggtggcactctgccaggcccgctgcccacacaaagcc
caggcccacaaggcggagcttgaccggctctgggctcgcatttgggccctcggtgtgcga
ggtgtcggctcaccccacacagagtctctcagcctggatctgctggcctccattgtgcac
ggcgggctggtgaatgtcgaccgagagttctggaaactcttctctgggtctgcatgcaag
ccatccaagagttctgctctttgtcttacccacacaatcctcaagtgtcctgtcccaaaa
agtgtcacgtcgagctccatctgggactctttgggagctacagagggatctccatcccct
tttttgaaagaaaatcttattgcttggctgctgctgagcaaccagaatgatgagaccgag
gacagcagcaggcctcatccaatcatctgcagagattttcctcataatctgatagcaaat
attttggtctcactgacactgaaagacacaagagttggcttgaagttcctactgggtaca
gagggagttgcaagcggctcttctcgagaccaagtagcatccgaggccaaagaaaacctg
gaggagattgagacactctacctgcactttagctttaatgcgtcagagatcccagcacgc
gccaacgagccggcgccgtcagccgactgtcagtttcccgccgtcctcggcctccgaaac
aagctggagcagcttgtgctttctgtggcggacagcctgctcaactgttattctcctgat
tctccgtccgttcctccggagtgcttggtgcgctgttgtgctctgctgattggtgttctg
gcgggctacgtctctacgggatgtgtgactcaggacgaggcctgctgctcccggctcttc
actaaagcaaaggccttggctcaggaactcagcggctttgtttccagtgtaaaagtgaaa
atgtcggacgaaggcgccatgtctagtctcagatcggttatgaagctgtgcactcagtcc
gcaagcaggaaacctgtggtccacgttaatgccgtctcctctggtttgttcgtactggct
ctaccagccagcctcatcagtgaatcggcagaaatctgcaaactgctgttaaatagttgg
tccaaaaaagtggatgatgatgagcaaatggaggaggactgggagatgactaaagttcag
ccagccggggacgaccacgacctttttgatgacggtgaaggttccagcagcttcaacggc
gccaacaggcagaaaggagacggtgctgacacctcctgccgcccgggtgcaaaatgtctg
ctggcagaggaaaacctgtcgcagcaggacacagctctcctggcagtcctggcgttcctg
tgcgagtgcggttccgtcccgcctgttcatggtctgcttttcaagcctcacgaggtgcgg
cgccggctgctgcttttcctggagcagatggatttcggcaaagccctgcacctcaacatg
tatcttgtcctgttgaagaaccttcctgctgaagactcgctctctgcagaggaattcgat
ttgctgctccgtcctctcgcggatctgtgcggtctgtatcgtcaggatcaggagatctgt
gttgctgtgctgctcagtttgttaccctccataaagagcctgggaagaactcgccccgtg
ctggaagacatgaaacacgtccaggggtgtctgctgcaagtggtgtctgggttttgcttc
ctaagcaagtcaggaaaatgttctgcgtctgtgagagcagctttagtgaggtgtcttgtt
gctttgcttgaggcagacccacactgtaactgggctattttgagcctcagaggggatgaa
ggggaggaagagcgtttgttgtcttctgtccttccatcttaccttgcagatgctgaccac
tatgtccgcatgcaggtggctacatccgtggagaggctgtttctggagatgaaaccagag
tttccaaaaatgagggagatgatgccgctgaaacaccagcaaaaagcttttgagcacatt
tacctgaaggctcaggaaggaatgaagcttcctggaaacaatcatttaaaggatgagcag
gacgagggcttcaaccgaaaggccaccctgctgaagagtttgtcggtcgtgctgtgttgc
agccccgtttgtgaaaaacagtgtctgtttgcacttttccagtcctacaaagagaacaac
ctcgaggagcagctcatcaaaaaggttttgtttagtgtgtcgaaggttctgggctacaag
agcgtgaaatccttcgtcacctcccacctcaactatctggtagctgagtggctggctcag
aggcagtctgatgaccgctacactcttggctcttttccttacagtcttctcgaccacgac
tctgtcaaagacttctacagctccacctaccaggtgctgatcccccgcttggtcttctta
gacgactttgagcaggtgaagtccatcggcaggtgcctggagaaggactggaggcttttg
ttagccaactgcttccccaaaatcatggtcaacattctgccgtactttgcgctgcctggc
caggatccacaggccgcaactcagagagagaaagctcacaaagtgtacgacctgctcaag
gacggcagctgtctggggaagcagcaaattgacagcctgatccacagtaacctggccgac
atcgtggtggagttgctcatgactctgtgtgagccgagcggagttgaagcagactgtgga
ggcctgaaacgcttcattggagagctcgatcctgcaccaaaccccccctgcttcagctct
gatgtcatcaccgctacgatggactacctcagcaagtgtcacagcgccaaccacaggtcc
ttggtcgccattctgtcaaaaacgccgatttctattcagaggattctattggcggtgtgc
gaaagagcagcagagacaactaacggctacgagcgccaccgcatcttgctcatgtaccac
ctgtttgtcagcctgctgctcggggaggtgaaagacggcctggggggcgcctgggccttc
gtcctccgagacgtcatctacaccctcattcaccacatcaacagcagaccgacggagtat
gacgaggtttcccagcgcagcctctccctgtgctgcgacctgctgacctctgtgtgtcag
gcggcgctgcagttctgcgatggtgccttagactgccacctgcaggtcattgtggggact
ctaacggcacaggtgaccagtcggcctgttatctccaaacaggtgttgagtttgttgcag
tttctcataatagaaaaccagcagaagttaaagggagccatccaaagtttggagcctttt
cccaaccttcctgactttaaagaactccgttctgtgcagcacaaactcaaatacaacgac
ggcaccttcacgctgagacaggagatcacccacttcctgtcggtggcctcctgtgactcc
ttacctctgaccaggcttgagggtcttaaggagctgaccagacaactgcatctcaacaag
gaacagcttcgagatctgctgaaagagtgccatgccgacccctctgacagcgtgctggtc
aagctcattctccgtctgttgcagctttgtaagttagcggtcaaccaccccggaggagct
gagattctcgaggcagcagggagctgcctgggagagctgggtccagtcgacctctccacc
attgcactccttcacggcagagatgctctctacaaccaggcagtggctctgttttcctct
acggagtcacagagtctttacatcatcctcaactgcatgaacgaggcactcacacagcag
cgaattgaggtgaagaaggcggcagctcagtgtgtgaagggtatcctggccacccaggct
ggagtggacttctgggacctgcacaaaagtaaccgcgaccccatgctggcgtacctgaat
ccattcagaacagccaagaataagttgtcagctttaagtgttgtggagagtttggaggcc
aaggcaaagctggagagccaggagttttggattccccagacgggcagccaccaaacctgg
ctgaaggagctttgcaccgctctactcgacagtggaggcgtcaggagccagcctttgctg
ctctcacgagacctatgtctggtcagcggggaccactgccagaggctgctccccctcatc
attcactccatccttctggatgacccctccggttcctggagggagctgctctcctcccac
atccaagagttcttcagtttctgtgcaagaaatgctcaggctgcaagtcggtctgccaca
cctctcatcccagataatgagtctcccgctcccactcagaactcatgtgacaagagctct
ctgcggaccatgctggctgctatcgactacctgagacatcagcagagaccgcttgattct
aagaggaactccggtggaacagtgtgtgactcaaacttttggctggacttgaactacctg
gttgtggccaaagctgctcagtcctgcttggcgcacttcaccgctctgctctacacagag
atctacgttgacaagatcaaagccaacatggaggaaacttgcagaaccaagtccagagca
tcacgcaaaattaactttgaagcgaacagtcagaccctcaccatctccagtctgacggag
aagagtgtggaagacgtcagcatcaatctgcaggagctgctgattgaagtttatcgcagc
atcggcgacccggacagtctgtacggctgtggaggagagacgatgaacagcccgttgata
aggattcgaacctatgaacatgaggctttgtggggaaaagctctgacctcatacgacctt
cacaccactctacctgaggtcactcgacaagttggaattgtggagggcctgcagaacttc
ggtctgagcaacatcctggccacttacatgagaggtctggagagtgagggggtggagtgg
ggagctgagctgcgagaacttcgcttccaagctgcttggaggaacagccagtgggactgt
gagctagcagagagaagtgagaaatccgtccctggctttcatgaatccatcttttgttct
ctgcaagcactgagggacaaagagttctccatgtttgatgaaacgctgaaacaggcccgg
cgtgctgaagtggaggagctctgcagggacagtctagaggccgtgtcttctctgtatcca
gccctcagaaacctgcagagcatcaaggagctggagagtttcaagcaactcttctccagg
cctttctctgatctggctctgagcaacatctgccgtcagtggcgtcagcactcccatttg
ctagccgacagcgacttcgctgtggtggagcccatactggcggtgcgctctgtggctcaa
cacgctctcttatccaaattgggaaacttgaacagcacgaacctcagttctgcgctcacg
gaccatctcatggagctctgctgtttggctcggaaggccggaaacacccagcttgcagag
cgtgcggtccaccagatgaagatacaggggggagcggggagctcgtggcagctgcaggag
gcccaggtttcctgggcaaagggagagcagggtctggctctgggccagctgagacagatg
attcacagtctagaggacaaggtggattttgaccctgatgtggttcctgcgtacaccgag
agcctcagactttgtgggaactggctggctgaaacctgtctggaaagtcctggagttatc
ctggaaaaatacttggagagggcagtggagctggttgaaggggaacgtggagctcaggac
tcccggctccagagccagcagaccgaggctttcttgtctctggctcgcttctccgatgct
cagtatcagagcatcgacaaatacatgaactcctctgagtttgagaacaagcaggcactg
ctggaaaaagctaaagaggagatgaacttgatgagacagcacaaagtcacctccaacagg
tacacgataaaggtgcagagagagctggagctggatgagaaggccctgtccaacctgcgg
acagacagacagcgcttcctgtgtaaggcggtggagaactacatccgctgtctggagcga
ggcgaagagcacgacacatgggtgttccgcctggcgtcgctctggctggagaacgctgac
atcaaagtcgtgaacaatgccatgaagaaaggagtgaagcagattccctcctacaagttc
ctgccgctcatgtatcagctggccgctcgcatgggaaccaagatggcgaacgggacctcc
gaggacacgggcttccatgatgtccttcatgacctgatctgtcgggcttccctggagcac
cctcaccacacactcttcatcatcttcgccctggtgaatgccaacaaagacgagaacttt
ggcaagactcggctgtccatgagcgctcccaggcagctcacaccttttgaccaggagcgc
tcccaggtggctcagaagatcatcaatgtgatcaggaaaaagcgtgcagagatgatccga
ggcattgagcgcctgtgtgacgcttacatcacgctggcttatatggatgctagcagacac
aaaaccgagaaaaaggctattcccatcccagccgaccagcccatcatgcagattaggaat
ctggaggaggttataatcccaacaatggagatgaaggtggatccgtctggttgctatgac
aacttggtgactgtcaggtccttcctgcctcactatcacctggccggaggggtcaacctg
cctaagatcatcgactgtgtgggctcggatggcaagagcaggagacagctgatcaaaggt
caggacgacatgcggcaggatgcagtgatgcagcaggtcttcagcatgtgctccatgttg
ctgcagcgcaataaggacactcggaagaggaagctgaacatccgaagatacaaggtggtg
ccgttctcgcagcgcagcggcgtgttggagtggtgctccggcaccatgcccatcggggag
tttctaacagaaccgaacaaaggagcccacaaacgctaccgacctcaggattggaccagc
ctggcctgtcgcaaaaaaatgatggaggctcagagtctgggattcgactacaagcttgag
gcctacatgaacgtttgcaaaaacttcagaccggtcttcaggtatttttgcatggaacga
ttcctagaccccgcgttatggatggagagacgactggcttacacccgcagtgttgccacc
tcctctatagtcggctacatcgtcggtctgggcgacagacacatccagaacattctgatc
gatgaggagactgctgaactggtgcacatcgatttaggagttgcctttgagcaggggaag
atcctccccacccctgagacggttcctttcaggctctccagagacattgtggacgggatg
ggcatcacaggagtggagggagttttcaggagatgttgtgagaagacgatggaagtgatg
aggagctctcaagaagctctgttgaccattgtggaggtgctgctgtacgaccctctgttt
gattggaccatgaaccctttgaaagccttccacctgcagcacgacgagcagcaggacctc
aacgccactcttggctccacaatgggaggtgttgacataaacgaccatcataaatccagc
gacagtcagagcttcaacaaggtggcggagcgggtgttgctgcgcctgcaggaaaagctg
aagggggtggaggatggagcggtgctgagcgtgggcggacaggtcaacctgctcattcaa
caagccatggaccccaaaaacctcagcagactcttctcgggatggcaggcctgggtgtag

DBGET integrated database retrieval system