KEGG   Oryzias latipes (Japanese medaka): 101167077Help
Entry
101167077         CDS       T02443                                 

Gene name
ppargc1a
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma coactivator 1-alpha isoform X1
  KO
K07202  alpha peroxisome proliferator-activated receptor gamma coactivator 1-alpha
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04371  Apelin signaling pathway
ola04910  Insulin signaling pathway
ola04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101167077 (ppargc1a)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101167077 (ppargc1a)
   04920 Adipocytokine signaling pathway
    101167077 (ppargc1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ola03029]
    101167077 (ppargc1a)
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101167077 (ppargc1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1
Motif
Other DBs
NCBI-GeneID: 101167077
NCBI-ProteinID: XP_023821574
LinkDB All DBs
Position
18
AA seq 941 aa AA seqDB search
MAWDRCNQDSVWTELECAALVGEDQPLCPDLPELDLSELDVSDLDADSFLGGLKWYSDQS
EIVSTQYGNEASNLFEKIDEENEANLLAVLTETLDSIPVDEDGLPSFEALADGDVTNASD
RSCPSSPDGSPRTPEPEEPSLLKKLLLAPANSQLSYNQYTGGKAQNHAASSNHRIRPPPA
VVKTESPWNGKARGGSSQQNRPVRRPCTELLKYLTATDDILLHTKGSEPKSAWGGASSKD
KSGLGLGASSSSSSPSSSSTSSFSSLSSISSSSSSTTTTKKKSALPSQQPLQQHHQRAKP
TTLPLPLTPESPNDYKGSPFENKTIERTLSVEIAGTPGLTPPTTPPHKASQENPFKASLK
TKLSSCSSSALTCKRSRLSELGACVVALAPGASAGGPARKGPEQTELYAQLSKASTALPY
TIAPYAVGGGLEEHRSPGNNKRACPRGHSDHDYCQASARSKAAGGTATVTTVEMTFTPRA
SDASMPSSGKVENGRLECKDSAMPAPFSPPSFSPSSASPGPLTKEQTPVSLEAEAGHCRG
SGEQTLTQASPIPAFGAASMRDQPQLCATSRKPLCDQEIRAELNKHFGHHPQAVHSQGGQ
EKEANCKRNKATAPQPAVAGENDYYSQKLLGSSYLHTGFLPFHDEIELGEGRDSRFVYPW
EGTPLDLLFDCSPSSPSCSPPSSCSPSRGSLSPPSSLLLSPNRPFCWTTSGSRSRSRSHS
GSRSSSSRYRRRSLSSSPDRRPPSWSRHSTDLNVSRSRTHKSPRPQSRSPLSRRPRYDSY
EEYQHERLKREEYRLDYEKREFERAEQREKQRQKAIEERRVVYVGRLRSDCTRTELKRRF
EVFGEIEECAVNLRDDGDNFGFITYRYTCDAFAALENGHTLRRPNDPQFELCFGGQKQFC
KSHYTDLDSHTDDFDPASTKSKYDSMDFDSLLREAQCSLRR
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgggacaggtgtaaccaagactcggtgtggacagaattagagtgtgctgccttg
gttggtgaagatcagcccctctgcccggacctccctgaacttgacctctcagagctggac
gtcagtgatttagatgcagacagcttcctgggcggcctcaaatggtacagtgaccaatca
gagatcgtttccactcagtatgggaatgaagcatcgaatctttttgagaagatagatgaa
gaaaatgaggccaacttgctggcagtgctcacagagaccctggacagcatcccggtggat
gaggacggattgccttcatttgaggccctggcagatggggacgtgaccaatgccagtgat
cggagctgtccctcctctcccgacggctcgccacgcaccccggagcccgaggagccttcc
ttgctgaagaagctccttctggcacctgcaaactcccagctcagctataatcaatacaca
ggtggcaaggcacagaaccatgcagccagcagcaaccatcggatcagaccaccacctgcc
gtcgtcaagacggagagcccctggaatggcaaggcaagagggggctccagccaacagaac
cgcccggtgaggcggccttgcactgagctgctaaaatacctaacagccactgatgacatc
ctactccacaccaaaggcagtgaacctaagagcgcctggggaggtgctagtagcaaagac
aagagcggattgggtcttggtgcctcttcgtcctcctcatcgccatcttcatcctccacc
tcctcgttctcctccctgtcgtctatatcctcctcctcctcctccaccaccaccacaaag
aagaagtcagctctgccatctcagcagccactgcagcagcatcaccagcgagccaaacca
accaccttgccacttcctttgaccccagagtctccaaatgactacaagggatcacctttt
gagaacaaaaccattgaacgcacattaagtgtggagattgctggaaccccaggtctgaca
ccaccaaccacgcccccacacaaagccagtcaagagaatcctttcaaagcatctctcaaa
accaagttgtcctcatgttcctcctcggccttgacatgcaaaagaagcaggttgagtgag
ttaggcgcctgcgttgtggccctggccccgggtgcctcagctgggggccccgccaggaag
ggtcccgaacagactgagctttacgcgcagctgagcaaagcgtccaccgccctcccttac
actattgctccatatgcagtagggggcggccttgaggagcaccgcagccctggcaacaac
aagcgggcctgtccccgcggccacagtgaccatgattattgccaggcatcagctcgttcc
aaggcggcagggggcacagccactgtgaccacagtggaaatgacatttaccccacgtgct
tctgatgcctcaatgcccagttctggcaaagtagagaacgggcgtctggaatgtaaggac
tcggccatgccagcacccttttcaccaccatctttttctccatcttcagcttcacctggc
cctttgactaaggagcagactccagtgtctctggaagcagaagcaggtcattgcaggggc
tcgggggagcaaaccctcacacaagccagtcctatccccgcattcggggccgcctccatg
agggaccaaccacaactctgtgccacgagccggaagcccctgtgcgaccaggaaatcaga
gcagagctcaacaagcactttggccaccacccacaagccgtccacagccagggtggccag
gaaaaagaggcgaactgcaaacggaacaaggctacagcccctcagcctgctgtggcggga
gaaaatgactattactcccagaagctgcttggctccagctacctgcacacagggtttctg
cctttccatgatgagatagagctgggcgagggccgtgacagtcgctttgtctacccttgg
gagggaacccctctggacctactctttgactgctctcccagctctccctcctgttcccca
ccatccagctgctccccctcccgaggctccctctccccgccttcctcccttctcctgtca
cccaatagacctttctgctggaccaccagcggatcccgctcccgctcccgttcccactcc
ggctcccgcagctcgtcatcacggtatcgccggcgctccctgtccagctcccctgataga
cgccccccctcctggtcgcgtcacagcacagatttgaatgtttctcgctccagaacccac
aagagtccccgcccccagtcacgctctcctctcagccgcaggccaaggtatgacagctat
gaggagtaccagcatgagaggctgaagagggaggagtaccgcctggattacgagaagcgg
gagtttgaaagggctgagcagagagaaaagcaacggcaaaaagccatagaggagaggagg
gtggtgtatgtggggcgactgaggtccgactgcacccggaccgagttgaagcgccgcttt
gaagtcttcggagaaattgaagaatgtgcagtgaacttgagggatgatggggacaatttt
ggcttcatcacctaccgctatacttgtgacgcctttgccgcccttgagaacggacacacc
ttacgcaggccaaacgatcctcagttcgagctgtgcttcggtggacaaaagcagttctgc
aaatcacattacacagacttggactcccatacggatgactttgatccagcctccacgaaa
agcaagtatgactccatggattttgacagtttgctgagggaggctcagtgcagcctgcga
aggtag

DBGET integrated database retrieval system