KEGG   Oryzias latipes (Japanese medaka): 101167461Help
Entry
101167461         CDS       T02443                                 

Definition
(RefSeq) homeobox protein Nkx-3.1-like
  KO
K09348  homeobox protein Nkx-3.1
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    101167461
Transcription factors [BR:ola03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    101167461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 101167461
NCBI-ProteinID: XP_004072522
UniProt: A0A3B3HVH9
LinkDB All DBs
Position
9
AA seq 188 aa AA seqDB search
MSSTVKPVTSFLIEDILSNKGSTGFSGKFSSLKTDRCSQRKEDLEQVPPQEYEKQTESVD
PSCCGSPQLNLNSTGKQKRSRAAFTHLQVLELEKKFNHQKYLSAPERAHLATSLRLTETQ
VKIWFQNRRYKTKRKQQTSEMCKDAYKADSLGLREDLVRSSLITSFYKAYQYKPYLWDCS
GPWAPALW
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccacggtcaaacctgtcacgtctttcctcatcgaggacattctgtccaataaa
ggcagcacaggatttagtggtaaattcagctctctgaagacagacagatgctctcagcgg
aaggaggatttggaacaagttcctcctcaggagtatgaaaaacagacagagtctgtagac
ccatcctgttgcggctccccacagctgaatttaaactccacggggaaacagaagcgctcc
cgagctgcgttcacccacctccaagtgctggagctggagaagaaatttaaccaccaaaaa
tacttgtctgccccggagagggctcacctggccacctccttaagactaaccgagacgcag
gtgaaaatctggttccagaacagaagatacaaaaccaaaagaaagcagcaaacatccgag
atgtgcaaggatgcatacaaagcagacagtttgggactaagagaggacttggtcagatca
tcactgattacctccttctataaagcttatcaatacaaaccttacctttgggactgcagt
ggcccctgggctccggcgttatggtga

DBGET integrated database retrieval system