KEGG   Oryzias latipes (Japanese medaka): 101167643
Entry
101167643         CDS       T02443                                 

Definition
(RefSeq) apoptosis-inducing factor 2-like
  KO
K22745  apoptosis-inducing factor 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101167643
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO Pyr_redox_3 GIDA Lycopene_cycl K_oxygenase NAD_binding_8 Thi4 HI0933_like FAD_binding_2 FAD_oxidored TrkA_N FAD_binding_3 Amino_oxidase AlaDh_PNT_C LSDAT_euk 3HCDH_N
Other DBs
NCBI-GeneID: 101167643
NCBI-ProteinID: XP_020565040
LinkDB
Position
15
AA seq 372 aa
MGGQVSIPEGVHVVVVGGGFAGIAAARQLKSRGVPFTLIDMKEAFHHNLAALRASVQPGF
AQRTFIPFAKTFGSSFVQGRVEHVDPERQAVFLQGGREIQYSHLILCTGTSGTFPGKVNA
VSSLEASVQKYEELVEQIQAADSVLVIGGGSTGVEMAAEIKTEYPEKKVVLINSRIGLAD
PVMMPSIRQQVKEVLLEKGVELLLGQKVSRMSELQLNKTQKNMKVSTERGETLTTDLIIC
CTGLKINSAAYSLGLMSSMADSGALRVNQYLQVHGFSNIFAVGDCSDTQKPKTAYLAGLQ
AAVAVTNILNSLRGAELKVYSTGNVTMLVAIGRNDGVGQFNGYRLPRFLVTLGKSRDLLL
WKSWKEMQQTQP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggggggacaggtctccataccagagggtgtccacgtggtggtggtgggcggaggattt
gcaggcatagcagcagcacggcagctgaaatctcggggggttccattcactctgatcgac
atgaaagaggcgtttcatcacaacttggctgcgctcagagcatccgtgcagccgggcttt
gctcaaaggacctttatcccgtttgctaagacgtttggatccagcttcgttcaaggccgc
gtggagcatgtggacccggagcggcaggctgtgtttctgcagggtggaagggaaatccag
tattcccacctcatcctgtgcaccggcaccagtggtacatttcctgggaaggtcaatgca
gtgtcatcgttggaagccagcgtgcagaaatacgaggaactggtggaacagatccaggca
gcagactcggttctggtgattgggggcgggtcgaccggtgtggagatggctgctgagatc
aagacggagtatccagagaagaaggtggttctgattaattccagaattggactggctgac
ccagtgatgatgcctagcatcagacagcaggtcaaagaggttcttctggagaagggggtg
gagctcctgctgggacaaaaagtaagccgaatgtcggagctgcaactcaacaagacccag
aagaacatgaaggtgagcacggaaagaggcgagacgctgaccacagacttgatcatctgc
tgcactggactcaagatcaactctgctgcctatagcttgggtctcatgagcagcatggct
gacagtggagctctgagggtaaaccagtatctgcaggtccatggattctccaacatcttt
gctgtgggtgactgcagtgacacacaaaagcccaagacagcgtacctcgctgggctccag
gctgctgttgccgtcaccaacatcctcaacagtctaaggggggcagagctcaaagtgtac
agcacaggtaatgtcaccatgctggtggcgattggcaggaatgacggcgtgggtcagttc
aacggttacaggctgcctcgcttcctcgtgaccctggggaaaagccgcgacctgctgttg
tggaagagctggaaggaaatgcaacagacccagccctga

KEGG   Oryzias latipes (Japanese medaka): 101167894
Entry
101167894         CDS       T02443                                 

Definition
(RefSeq) apoptosis-inducing factor 2
  KO
K22745  apoptosis-inducing factor 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101167894
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 DAO GIDA K_oxygenase NAD_binding_8 Lycopene_cycl NAD_binding_9 FAD_oxidored Thi4 FAD_binding_2 FAD_binding_3 HI0933_like Amino_oxidase AlaDh_PNT_C XdhC_C
Other DBs
NCBI-GeneID: 101167894
NCBI-ProteinID: XP_011482528
UniProt: H2LCS9
LinkDB
Position
15
AA seq 372 aa
MGGQVSLPEGVHVVVVGGGFGGIAAAQQLKSEGVPFTLIDMREAFHHNVAGLRASVQPGF
AQRTFIPFAKTFGSSFVQGRVENVDPDRQTVILQGGREIQYSHLILCTGTDGPFPGKFNA
VSSLEASVQKYEELVEQIQAADSVLVIGGGSTGVEMAAEIKTEYPEKKVVLIHSRIGLAD
PELTSSVRQQAKDVLLEKGVELLLGQKVSRMSELQLNKTQKNMKVSTERGETLTTDLIIC
CTGLKINSAAYSLGLKDSIDDSGALRVNQYLQVHGFSNIFAVGDCSGTQKPKTAYVAGLQ
AAVAVTNILNSLRGAELKVYSTGNVTMLLAMGRNDGVGQFNGYRLPRFLVTLGKSRDLLL
WKSWKEMQQTQP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggggggacaggtctcgctaccagagggtgtccacgtggtggtggtgggcggaggattc
ggcggcatagcggcggcccagcagctgaagtctgagggggttccattcactctgatcgac
atgagagaggcgtttcaccacaacgtggctgggctcagagcatccgtgcagccgggcttt
gctcaaaggacctttatcccgtttgctaagacgtttggatccagctttgttcagggccgt
gtagagaatgtggacccggaccggcagacggtgattctgcagggtggaagggaaatccag
tattcccacctcatcctgtgcactggcaccgacggtccgtttcccgggaagttcaatgca
gtgtcatcgttggaagccagcgtgcagaaatatgaggaactggtggaacagatccaggcg
gcagactcggttctggtgattgggggcgggtcgaccggtgtggagatggctgctgagatc
aagacggagtatccagagaagaaggtggttctaatacactccagaattggactggctgac
ccagagctgacttctagcgtcagacagcaggcaaaagatgttcttctggagaagggggtg
gagctcctgctgggacaaaaagtaagtcgaatgtcggagctgcagctcaacaagacccag
aagaacatgaaggtgagcacggaaagaggcgagacgctaaccacagacttgatcatctgc
tgcactggactcaagatcaactctgctgcctatagcttgggtctcaaggacagcatagat
gacagtggagctctgagggtaaaccagtatctgcaggtccatggattctccaacatcttt
gctgtgggtgactgcagtggcacacaaaagcccaagacagcgtacgtcgccgggctccag
gctgctgttgccgtcaccaacatcctcaacagtctgaggggggcagagctcaaagtgtac
agcacaggtaatgtcaccatgctgctggcaatgggccggaatgacggagtgggtcagttc
aacggttacaggctgcctcgcttcctcgtgaccctggggaaaagccgtgacctgctgctg
tggaagagctggaaggaaatgcaacagacccagccctga

DBGET integrated database retrieval system