KEGG   Oryzias latipes (Japanese medaka): 101168167
Entry
101168167         CDS       T02443                                 

Gene name
igf1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04150  mTOR signaling pathway
ola04510  Focal adhesion
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101168167 (igf1)
   04068 FoxO signaling pathway
    101168167 (igf1)
   04150 mTOR signaling pathway
    101168167 (igf1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101168167 (igf1)
   04115 p53 signaling pathway
    101168167 (igf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101168167 (igf1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101168167 (igf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    101168167 (igf1)
Cytokines and growth factors [BR:ola04052]
 Growth factors
  Growth factors (RTK binding)
   101168167 (igf1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 101168167
NCBI-ProteinID: XP_023808206
LinkDB
Position
23
AA seq 185 aa
MSNAHFSQWHLCHVLKGAMRCISCSHTLSLLLCVLTLTPTSSGAGPETLCGAELVDTLQF
VCGDRGFYFSKPTGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSKAARSVRAQRH
TDVPRKVSTPGQRAEKATERRTSQHSDKTKNKKRPLPGHSHSSFKQDVHQKNSSRGNHGG
RSYRM
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtctaacgctcatttctctcaatggcatttatgtcatgtcctcaagggtgcgatgcgc
tgtatctcctgtagccacaccctctcactactgctgtgcgtcctcaccctgactccgacg
tcatcaggggcgggtcccgaaaccctgtgcggggcggagctggtggacacgctgcagttt
gtctgtggagatagaggcttttatttcagtaaaccaacgggctacggtcccaatgcgcgg
cggtcacgcggcattgtggacgagtgctgcttccaaagctgtgagctccggcgcctggag
atgtactgcgcgccggcgaagacgagcaaggcagctcgctctgtgcgcgctcagcgccac
acagacgtgcccagaaaggtcagtactccaggacagagagcggagaaggccacggagcgg
aggacctcacagcattcagacaagacaaaaaacaagaagagacctttacccgggcatagt
cattcatccttcaagcaggacgtgcatcagaaaaactccagtcgaggcaaccacggcggc
agaagttaccgaatgtag

KEGG   Oryzias latipes (Japanese medaka): 105354483
Entry
105354483         CDS       T02443                                 

Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04068  FoxO signaling pathway
ola04114  Oocyte meiosis
ola04115  p53 signaling pathway
ola04150  mTOR signaling pathway
ola04510  Focal adhesion
ola04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105354483
   04068 FoxO signaling pathway
    105354483
   04150 mTOR signaling pathway
    105354483
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105354483
   04115 p53 signaling pathway
    105354483
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105354483
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    105354483
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    105354483
Cytokines and growth factors [BR:ola04052]
 Growth factors
  Growth factors (RTK binding)
   105354483
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 105354483
NCBI-ProteinID: XP_011476003
LinkDB
Position
7
AA seq 166 aa
MPPSCPLPGRPPTLQVLGVQVCVFLSSLSLWGPALSAEAARLRCGSELLSDLLFVCGDRG
IYMGKGSWSGYGSRPRGRGIVDHCCRPPGCELQDLDMYCAKAKSPVGTTPSPPTTTASST
TTSHMFQTVFQRRRMELQRTNGTRTDSPTRKVPLSVQWGVRSALIP
NT seq 501 nt   +upstreamnt  +downstreamnt
atgcccccgtcttgccccctccctggccggcctcccacgctccaggtgctcggcgttcag
gtctgcgtgttcctgtccagcctgagcctgtgggggcccgcgctctcggcagaggcagcc
agactgcgctgtggctcagagctgctcagcgacctgctgttcgtgtgcggagaccgaggc
atctacatgggtaaaggctcctggtccgggtacggttctagacccagagggcggggcatt
gtggaccactgttgcaggcctcctggctgtgagcttcaggatctggacatgtactgtgcc
aaagccaagagcccggtgggcaccaccccctcccctcccacaaccaccgcaagcagcacg
accacctctcacatgttccagacagtgttccagagaaggaggatggaactgcagagaacc
aacggcaccaggacggactcccccaccagaaaagtgccgctttctgttcagtggggggtg
cggagcgccctcattccatag

DBGET integrated database retrieval system