KEGG   Oryzias latipes (Japanese medaka): 101168194Help
Entry
101168194         CDS       T02443                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ola01002]
    101168194 (tmprss9)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101168194 (tmprss9)
Peptidases [BR:ola01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101168194 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Ldl_recept_a Trypsin_2 SEA DUF1986
Motif
Other DBs
NCBI-GeneID: 101168194
NCBI-ProteinID: XP_023809895
LinkDB All DBs
Position
4
AA seq 785 aa AA seqDB search
MEVKKDERGAPSASPSNGSNKSIFIACIIFFLLVGIGVGFVIAYLLQEPQHFIETVELKG
LEYTPDLEDENSAFTIILSSSLKSKIKNIFIASSVSNNYKECSIIAYGNTNGDVIATVRL
IFMVSRIQQFSYNFVRDLLRAGFSSVMQGKPLEVPGFGAISAVFLLGARGKSFYAVGDAK
MASCPATAFTCDDGECVTKINPECDFIPDCADESDEAHCACGSRPAVESRIVGGVDAHLG
EIPWQVSLRFHGLHTCGASILSDRWLVSAAHCFERENDPKDWTALVGASQRKGDEVGSKI
VNIKSIVVDPAYDPETSNNDVSVLELESPLSFSPHIQPICIPAASHVFPPSQNCVVSGWG
ALNEFSFSLPSTLQKAVVKIIDTKECNKSSAYNGAVSDLMMCAGFLQGKVDSCQGDSGGP
LVCEGAPGKFFLAGVVSWGVGCAQINRPGVYSRITKLRNWILRHTDPSMVHDYMQPLPTV
PALTQATSANLSVSWEVSSEQTPAINCSESFQCSSALCITKVNPECDGVPDCSNGADERN
CDCGLRPALGPQKIVGGVTARKGEWPWIGILQHQRLYRCGATLIHNKWLLTAAHCFKSDP
SPTDWAVSLGSVLRSGAGALVIPIQRVIIHPEFNGTRMDHDVALLELAVPAPMSYTIQTA
CLPSPVHSFLQNAECYIAGWGSMKEGGSLANLLQKAEVKIIEQADCQLSYGDALTQNMMC
AGLMEGGRDTCLGDSGGPLTCRDLSGRWFIAGVTSWGHGCGRVGFPGVYTRVTSVRKWIS
KYLPF
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaagaaggatgaaagaggagccccatctgcttcacccagcaatggctccaac
aagagcatcttcatcgcctgcattatcttcttcctactcgtaggtatcggtgtgggcttt
gttatagcgtacctgctgcaggagccgcagcatttcattgagacggttgaactcaagggt
ttggagtacactcctgatctggaggacgagaactcggctttcaccatcatactctcctca
tctctaaaatcaaagattaaaaatatcttcattgcctcatcggtatcaaataactataag
gaatgcagcattatcgcttatggcaacaccaacggtgacgtgatcgcgacagtcagactc
atcttcatggtgtccagaatccagcagttttcatacaactttgtccgggacctgctgagg
gcaggcttcagctccgtcatgcaggggaaacctctggaggtgccgggcttcggggccatc
agcgccgtctttttattgggagccagaggaaagtcgttttatgcagtcggagacgcaaaa
atggccagttgtccagccacggctttcacctgtgacgatggagagtgtgtcaccaaaata
aacccagagtgtgacttcatcccagactgtgcagatgaatccgatgaagctcactgtgcg
tgcggttcccggccggctgtggagagtcggattgtgggcggggttgatgctcacctgggg
gagattccttggcaggtcagtctgaggttccacggtcttcacacctgtggagcctccatc
ctcagcgaccgctggctggtcagtgctgcacactgctttgagagagaaaatgaccccaaa
gactggacagctctggttggagccagccagagaaaaggggacgaggtcgggtctaaaata
gtaaacatcaagtcaatagttgtggatccagcgtatgatccagagacctccaacaacgac
gtgtccgtgctggagctggagagccccctgagcttcagcccccacatccaaccgatctgc
attcctgctgcgtcgcacgtctttccacccagccagaactgcgttgtgtccggctggggc
gccttaaacgagttcagcttctcgttgccttcaacactgcagaaagctgtggtaaaaatc
attgacaccaaggagtgcaacaaatcctctgcatacaacggggctgtgagtgacctcatg
atgtgtgctggattcctacaaggcaaagtggactcttgtcagggtgactctggggggcct
ttggtgtgtgagggggccccagggaagttcttcctggctggcgtggtgagctggggtgtg
ggctgtgcccagatcaaccgacctggggtatactcccgcattaccaaactgcggaactgg
attttgaggcacacggatcccagcatggtgcacgattacatgcagcctcttcccaccgtc
cccgctctgacgcaagccacctccgctaacctgtcggtgtcctgggaagtgtcttctgaa
cagacacctgcaataaactgcagtgaaagcttccagtgcagctctgcgttgtgtattacc
aaagtgaaccctgagtgtgacggagtccctgactgctccaatggggcggatgaaagaaac
tgtgactgcggcctgcgtccagcgctgggtcctcagaagatcgtcggtggagttacagct
cggaaaggagagtggccttggattggcatcctgcagcaccaaagactttaccgctgtggg
gccacgctcattcacaataagtggttactgactgcagcacattgttttaaaagtgacccc
agtcccacagattgggctgtaagccttggctcggttctgcgatctggagcgggggccctg
gtcatccccatccaaagggttatcattcatccagagttcaacggcactcgcatggatcat
gatgttgctttgctggagctggcagtccccgcccccatgtcctacaccatccagactgcg
tgtcttccgtctcccgtgcacagcttcctgcagaacgcagagtgctacatcgcaggctgg
gggtccatgaaggaaggaggttcgcttgccaacttgctgcagaaagctgaagtgaagatc
attgagcaggcagactgccagctctcctatggagatgcgctgactcagaacatgatgtgt
gctggcctcatggagggaggcagagacacctgtttgggtgattctggggggcccctgact
tgccgtgacctctctggccggtggtttattgccggagtgacgagctggggtcacgggtgc
ggacgagttggctttccaggggtttacactcgtgtgacatcggtcaggaagtggatatca
aaatacctgcccttctaa

DBGET integrated database retrieval system