KEGG   Oryzias latipes (Japanese medaka): 101168213
Entry
101168213         CDS       T02443                                 

Definition
(RefSeq) apoptosis regulator BAX isoform X2
  KO
K02159  apoptosis regulator BAX
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04141  Protein processing in endoplasmic reticulum
ola04210  Apoptosis
ola04217  Necroptosis
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101168213
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101168213
   04217 Necroptosis
    101168213
   04115 p53 signaling pathway
    101168213
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101168213
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101168213
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ola03029]
    101168213
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ola02000]
    101168213
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101168213
Transporters [BR:ola02000]
 Other transporters
  Pores ion channels [TC:1]
   101168213
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101168213
NCBI-ProteinID: XP_004071362
UniProt: H2LIC3
LinkDB
Position
8
AA seq 188 aa
MASHPGGGDQEKSKELLDVGTKLLKNFICERVRRNLQDDSEVVRQQLGAEELVDPNHKRL
AQCLQQIGDELDGNVELKRLIDDSSLSPSKEVFLKVALEIFSDGVYNWGRVVTLFYFACR
LVIKALITKVPDIIRTIFTWTIDYLRDYVIAWIREQGGWDGIFGTPGWQTLAVFVAGVLT
AAVVIRKM
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcatcgcaccccggaggaggcgatcaagaaaaatccaaagagctactggatgtgggc
accaagttgctgaagaacttcatctgtgaacgggtcaggagaaacctgcaggatgactct
gaagtggtcagacagcagctgggtgcagaggagctggttgacccaaaccacaagagactt
gctcaatgcctccagcagattggagatgagctggatgggaatgtagagctcaaaagattg
attgatgactcttcgctcagtccctccaaagaagtgtttctaaaagtggccctcgagatt
ttttctgatggggtatacaactggggccgggtggttacacttttctacttcgcctgtcgg
ctggtcataaaggctctcatcacaaaagtaccagacatcattagaactatattcacctgg
accatagattaccttcgggattatgtgattgcctggataagagagcaaggcggctgggat
ggcatctttggcactcctggctggcagacgttggccgtctttgttgcaggcgttctcacc
gctgcggtggtcattcgcaagatgtga

KEGG   Oryzias latipes (Japanese medaka): 101168687
Entry
101168687         CDS       T02443                                 

Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04141  Protein processing in endoplasmic reticulum
ola04210  Apoptosis
ola04217  Necroptosis
ola05132  Salmonella infection
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101168687
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101168687
   04217 Necroptosis
    101168687
   04115 p53 signaling pathway
    101168687
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101168687
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101168687
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ola03029]
    101168687
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ola02000]
    101168687
Mitochondrial biogenesis [BR:ola03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    101168687
Transporters [BR:ola02000]
 Other transporters
  Pores ion channels [TC:1]
   101168687
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 101168687
NCBI-ProteinID: XP_004066850
LinkDB
Position
3
AA seq 285 aa
MARAPPGFRLRCACLRRCRSRLAPLALPRRGPARPRWSSRDFRVQLKTLDISRGHRVFHG
GFTEPDSKVGGRSRTSPSSGSMADGGGEDRAEGAEPRGAEGGEDVFDDPILEQGAVVLRG
YVIERINLQDPDLYVSSEDLGGSPNEQEDPQIKEVVEQLLKIADDINRNAVLQQLINQAS
GSGAQDIFMEVARSIFADGINWGRVVALFHLAYKFIYKALTSNHLETIRMIISWVLQVIK
EVLYPWLVQQGGWVGVIQRFSRWRTLTVAASIVLLAAFVYYRKTR
NT seq 858 nt   +upstreamnt  +downstreamnt
atggcgcgcgcgccgcccggtttccggttaaggtgtgcgtgtctgagacgctgcagatca
aggctggccccgctggccctgccccgccgcggcccggcccggccccgctggtcctcacgg
gacttccgcgttcaactaaaaacgctcgacattagccgcggacaccgcgtcttccacggc
ggctttactgaaccggactctaaagttggaggcagaagtcggacttctccgtcatctggg
tccatggctgacggcgggggggaggacagggcggagggcgcggagccgcggggcgccgag
ggcggggaagatgtttttgatgatcccatcttggagcaaggagcggtggtcctcagaggg
tacgtgattgaaaggataaacttacaggaccctgatttatacgtgtcgtctgaggatctg
ggaggaagtccaaacgaacaagaagatccacaaatcaaagaagtggtggagcagctgctc
aagatagcagatgacatcaacaggaatgctgtgctacagcaattgatcaaccaggcgtct
ggtagcggtgcacaggacatcttcatggaagtggccaggagcatctttgctgatgggatc
aactggggtcgagtggtggctctctttcacctggcctacaaattcatatacaaggcactg
accagcaaccatctagagaccatcagaatgataatcagctgggtactgcaagtcatcaaa
gaagtgctctatccctggctggtgcagcagggaggttgggtgggcgttatccaacgtttt
tcacgctggagaacattgaccgttgcagcgtcaatagtattgcttgcagcctttgtttac
tacaggaagacgcgctga

DBGET integrated database retrieval system