KEGG   Oryzias latipes (Japanese medaka): 101168387
Entry
101168387         CDS       T02443                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1 isoform X5
  KO
K18496  fibroblast growth factor 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101168387 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101168387 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    101168387 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:ola00536]
    101168387 (fgf1)
Cytokines and growth factors [BR:ola04052]
 Growth factors
  Growth factors (RTK binding)
   101168387 (fgf1)
Glycosaminoglycan binding proteins [BR:ola00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   101168387 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101168387
NCBI-ProteinID: XP_004076167
LinkDB
Position
14
AA seq 182 aa
MDALAHQECCHVTFSQTHRPATSAPHSLFGMSEGDISVLPFPSASLDLSKEEPQKLTRLY
SQKGGYHLRISLDGTVNGGRQENDPYDILKIKAVSAGVVVIKGEASGRYLAMSKKGHLYG
SQALTDECYFVEKYEENNYNTYRSQKYGWYVALKKNGQPKAGPDTHQGQKAIFFLPRSAG
NV
NT seq 549 nt   +upstreamnt  +downstreamnt
atggacgctctggctcatcaggagtgctgtcatgtgaccttctcccagactcatcgccct
gctacatctgcacctcacagtctttttgggatgtctgagggagatatttcagtgctgcca
ttcccatctgcatctctggatttatccaaggaagagccacaaaagctgaccaggctctac
agtcagaaaggaggatatcacctgaggatttcactggacggaactgtgaacggtggacgg
caggagaacgacccatatgacatcctgaagataaaagctgtgagtgcaggagtggtggtc
atcaaaggggaagcctcaggaagatacttggccatgagcaagaaaggacatctgtatgga
tcccaagcactaaccgatgagtgctacttcgtggagaagtacgaggagaacaactacaac
acgtatcgctctcagaaatacggctggtatgttgctttgaagaagaacggccagcccaaa
gcaggacctgacacccaccagggtcagaaggccatctttttcttaccgcggtctgcaggc
aatgtttga

DBGET integrated database retrieval system