KEGG   Oryzias latipes (Japanese medaka): 101168435
Entry
101168435         CDS       T02443                                 

Gene name
tsc2
Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04218  Cellular senescence
ola04910  Insulin signaling pathway
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    101168435 (tsc2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101168435 (tsc2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101168435 (tsc2)
   04218 Cellular senescence
    101168435 (tsc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101168435 (tsc2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101168435 (tsc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101168435 (tsc2)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101168435 (tsc2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP HEAT
Other DBs
NCBI-GeneID: 101168435
NCBI-ProteinID: XP_023815357
LinkDB
Position
1
AA seq 1849 aa
MNKQQSKESLKDKVKGILGLGGPRPPSKQSDFKPSEFIITTDIIRELHPDCGLSNRVRTM
NHICDLAKSKKFEENAVEAVWKAVEDMLAPEQPPEARHAVLQLLRAIIQGQGERLGPLRA
YFFKVIRDYQPSNEDLSDRLEVFKALTENGKDITYLEEDIARFVLLWMDIGLTSDFLHVL
VNLVKFNSCYLDQNVSIMVQKICLLCNRTTSSTDIEVALQVLDAVVCYNCLPSDSLTIFI
ITLCRTVNVKEFCESCWKLMRKVLGTHLGHSAIYTMCRIMEERMYMEDAPLLRGAVFFVG
MALWGAHRLPALKNTPTLVLPSFYKAMSSANEVVSYEIVLSITRLIKKYGKELQVVTWDI
LLSIIERLLQQIQTIGSAELKAIVYELLTTVEELYEQNSYHGSAEKFFSLVEKCADKRPD
ASVLTLISYRAQSIQPARDGWIQSLHRLMENFFRNENRTVIRIKVLHILSFVLSTNRQLY
EDELIEMVVIPQLSGIAEDKDLAVRKQATQLLVDLAEGCNTHHFTSLLDVIERVASRSLV
CSGPLDISDRDPTAESPMEDVRTAILGLMEILQSKLYSLPASHASRVYEMLVSHLQLHYK
NKYCSAVSAAIRLKVFDFFLMMRADSLHRIGVPNKDGAIRFSPYCHCDASEPEKREKKPT
GSTSPPAGSPAPAAASTASMRSAYLPYSHAFGVLLQCLKMESDWKVLKLVLDKLPWTLQY
KVLLLTSPCSLDQLCSTLCCMVTDRLISERLKKTPEVFSRTDVQLAVVPVLTAVTSYHVY
LEQSRQRELVQCLETGLIYRCAKQCVVALTMCTVEMPDIMIKLLPALIVKLTHISATVAM
ASPMLEFLSTLVRLPHLYANFVAEQYVSVFAISLPYTNPSKFNQYIVSLAHHVIAMWFIR
CRLPFRKDFVQYITKGLRSNALLPFDDGHEQSPFRARSTSLNERPKSHRAPKVAKAAAGN
SSGSPVKELRDRSAMEAFRCRSISVSEHAVRRMHTSTTTCSLGSADENAVTQADEGLKTV
HLELTETCLDMMARYVFSNFSALPKRSPIAEFLLAGGRSMTWLVGNKLVTITTSGGVRTQ
ALLGLDMSERLGGGEMTRSDPSLHTRMTKEAPAKLESQSSQQQSRSTRIRVRSISGGHAL
RAGPAQSLSPLVSPSEGELATPLSPSHGPALESGGPPSSSGISSAPPPLKDNPSLAEFVP
MLTQGWAEIFIRRPSGNTSWLMCLENPPSPFSSEVSNMPLQELSSVLMAMEGVKEPPVQT
ASAPASTAAPAPTSISEPMSHGIHSSSGGRPHLIQRSNTDSVVEESSGVAVVPFWSESEF
EAMPCDAIFMSAEKLSRTPPPEGLSRSSSTSSQEDEKSTLEEVSEGAIPIDQPPLGPSTP
GSQGVELPFQSHSQSQGFGLNKSSSSPELQTLPEAFSKVLESDASEAAAFSDAKPQVLPP
PSEKDGVEGGSGGDTTDGLPAPSHKGEGSAPSSQGGGAALRLPLPAAQSATISPGGGYRP
RGHTISVSAPSRRDRRAERDSYHGRAGPSPTEKASGLSPSFVFLQLYHSPFFGNEANKPL
LLPKTQVIDRAVKVLDQMPPYDTHKIGVVFVGAGQVNNEVAILSNEYGSNRYAAFLTGLG
KLIHLKDCDSDQIFLGGLDQYGDDGEFTYCWHDDIMQAIFHIATLMPNRESDRGCCNKKR
HIGNDFVMVVYNDSGEEYKLGTIKGQFNFVEVIIKPLDYDCNLVTLQCRKDLEGLVDTTV
AKIVSDRNLPLLVRQMALHANMASLVHQYRANPSDAYASKWLARLRHIKRIRTRAQEDIQ
SRSTPGISLTQGHAQQNKSFQQNTPTPNPEASGQRKRLVSTVDDFTDFV
NT seq 5550 nt   +upstreamnt  +downstreamnt
atgaataaacaacagagcaaggagagtctaaaggacaaggtgaaggggatcttggggctt
ggaggtccacgtccgccgagcaagcagagtgacttcaaaccctcagagttcatcatcacc
actgacatcatcagggaactccatccagactgtggcctgagcaaccgcgtccgcacgatg
aaccacatctgtgacctggctaaaagcaagaagtttgaggagaacgcggtggaggccgtg
tggaaggccgtggaggacatgcttgctccagagcagcccccagaggccagacacgccgtc
ctgcagcttctgagggccatcatacagggacagggggaacgcctcgggcctctgagggca
tacttcttcaaggtgatccgagattaccagccgagcaatgaggatctgtctgacagactg
gaggtgttcaaagccttaaccgagaacgggaaggacataacgtacctggaggaggatatc
gcccgcttcgttctcctgtggatggacatcggtctcacctctgattttcttcacgttctt
gtaaacctggtgaagttcaacagctgctatctggaccagaacgtctccatcatggtccag
aaaatctgtctgctctgcaacagaaccacatcttctacagacattgaggtggcgctgcag
gtgctggatgctgttgtgtgttacaactgcctaccttcagactctctcaccatcttcatc
ataacgctctgccggaccgtcaatgtgaaggagttctgtgagtcctgttggaagctgatg
aggaaagtcctgggaactcacctgggccacagtgccatctacaccatgtgtcgcatcatg
gaggagaggatgtacatggaagatgctccgctgctgagaggagccgtgttcttcgtcggc
atggcgctgtggggggcacacagactcccagctctgaaaaacacccccacacttgtgctg
ccatccttctacaaggccatgtcttctgccaacgaggtggtttcgtatgaaattgtcctg
tccataaccaggctgatcaagaagtatggtaaagagttgcaggtggtcacgtgggacatc
ctcctgagcatcattgagcggctgctgcagcagatccagaccataggcagtgcagagctg
aaagccatcgtctacgagctgctaaccaccgtggaggagctgtacgagcagaacagctac
cacggctccgctgagaagttcttcagcctggtggaaaagtgtgcagataagaggcctgat
gcctctgtgctgaccctcatttcatacagggcacagtccatccagcctgcaagggacggc
tggatccagagtcttcaccgcctgatggagaacttcttcaggaacgaaaaccggactgtg
atcaggatcaaagtgcttcatatcctgtccttcgttctcagcaccaaccggcagctttat
gaggatgagttgattgaaatggtggtgatccctcagctcagtggtattgctgaagacaag
gacctggctgtcaggaagcaggccactcagctgctggtggacctcgccgagggctgcaac
acccaccatttcaccagcctgctggacgtcatcgagcgggtggccagccgttctctggtg
tgttcaggaccgttggacatttctgacagagatcctacagcagagtccccgatggaagac
gtcagaacggccatactgggtctgatggaaatcctgcagagcaaactctacagcctccca
gccagccacgcctcccgcgtgtacgagatgctcgtcagccacctgcagctccactacaag
aacaagtactgttctgctgtctccgctgccatcagacttaaggtctttgacttcttcctg
atgatgcgcgcagactcccttcaccgcattggggttcccaacaaagacggagccattcgg
ttcagcccttattgccactgcgacgccagtgaacctgaaaagcgggagaaaaagcccaca
ggctctacgtcgccccctgctggcagcccagcaccagcagcagcctctacggcctccatg
cgctccgcttacctcccgtattcacacgcctttggtgtcctgctgcagtgcctcaagatg
gagtccgactggaaggttctgaagctggttctggataagcttccctggacgctgcagtat
aaagtgctgctgctcacgtctccctgcagtctggaccagctgtgctccaccctctgctgc
atggtgacggatcgactcatctctgagcgtttgaaaaagaccccggaggtgttttctcgc
acagatgttcagctggcagtggttcccgttctgacggctgtgacttcttaccacgtctac
ctggagcagtccagacagagggaactggttcagtgccttgagaccggcctcatctaccgc
tgtgccaagcagtgtgttgttgccctcaccatgtgcacggtggaaatgcccgacatcatg
attaagctcctccctgcactcatcgtcaagctcacacacatctctgccacggtcgccatg
gcgtccccaatgctggagtttctctccactctggtgcgtctgcctcatctttatgccaac
tttgtggctgagcagtatgtgagcgtgtttgctatctctctgccctacaccaacccctcc
aagttcaaccagtacatcgtgtccttggctcaccatgtgatcgccatgtggttcattcgc
tgccggcttcctttccgcaaggactttgtgcagtacatcacaaagggtctgcgctccaac
gcgctgctgccgttcgacgacggtcacgagcaaagcccgttccgtgcacgaagcaccagc
ctcaacgaaaggcccaaaagccaccgggcgcccaaagtggcaaaggcagctgcgggaaat
agcagcggctccccggtaaaagagctgcgggaccgctcagccatggaggcgttccgctgc
cgcagcatcagcgtctccgaacacgcggtccgcaggatgcacacctccaccaccacctgc
agtctgggctctgctgatgaaaatgccgtgactcaggcagatgaaggacttaagaccgtc
cacctggagctcacagagacctgcttggacatgatggctcgatacgtcttctctaacttt
tctgctctgcccaagaggtctcccattgcagagttcctgctggcaggggggcgcagcatg
acctggttggtaggcaacaagctggtgaccatcacaaccagtggaggagtcagaacccaa
gcactgctgggtctggacatgtctgagcgcctgggaggaggagagatgaccaggtctgac
ccgtctctgcacacccgaatgaccaaagaggctccagccaagctggagtcgcagtccagc
cagcagcagagcagatccacacgcatccgtgtgcgctccatctcaggaggtcacgctctt
cgcgcaggtcccgctcagagtctcagtcctctggtgtctccatcggagggggagctggcc
acgcctctgtctccctcccatggtcctgctttggagagcgggggcccaccgtcgtcctct
ggcatctcgtctgctccccctcctctcaaagacaaccccagcctggcagagtttgtccct
atgctcactcagggatgggcggagatcttcatccggaggccttcaggaaacaccagttgg
ttgatgtgtctggagaacccccccagccccttctcctcggaggtcagcaacatgccgctg
caagagctgtccagtgtcctcatggccatggagggggtgaaggagcctcctgttcagacc
gccagcgcccccgccagcacagctgcccccgcccccacatccatctctgaacccatgtct
cacgggatccacagcagcagtggagggaggccacacctgatccagcgttccaacacagat
tctgtggtggaggaaagctcaggtgttgccgtcgtgcctttctggtctgaaagcgagttt
gaggcgatgccttgtgatgccatctttatgtctgcggagaagctcagcagaactccgcct
cctgagggactcagcagatcgtcctccacctccagtcaggaggatgaaaagtccaccttg
gaggaagtaagtgaaggagccattcccattgatcagcccccccttggaccctccactccg
ggcagtcagggggtggagctcccgtttcagagccattctcagtcccaaggttttggactc
aacaagtccagttcgtccccggagctgcagacgttacccgaggccttcagcaaggtgctg
gagtcagacgcgtctgaggcagcggcgttctcagacgccaaacctcaggtactgccgccc
ccctccgagaaggatggcgtagagggcggttcagggggggacactactgatggactccca
gcaccgagtcataaaggcgaaggctcagctccatcctcccaaggagggggtgcagccctg
aggctgcctctccctgcagcgcagtcggcgaccatttctcctggtgggggctacagacct
cggggtcacacaatctctgtgtcagcaccctcccggagggacagaagggcagaaagggac
tcctaccatggacgagcaggcccaagccccaccgagaaagcctctggactgagccccagc
tttgtcttcctgcagctctatcactcgcctttctttgggaatgaagccaacaagccgctg
ctgctacccaaaactcaggtcatcgaccgcgctgtgaaggttctggaccagatgcctccg
tacgacacgcacaagatcggagtggtgtttgttggggctggtcaggtcaacaatgaagtt
gccatcctgtcaaatgaatacggctccaaccgatacgccgccttcctcaccggactcggg
aagttaatccacctgaaggactgcgactctgaccagatcttcctgggggggctggaccag
tatggagacgatggggagttcacgtactgctggcatgacgacattatgcaggcaatcttc
cacatcgccacgctgatgccgaaccgagagagcgacagaggctgctgcaacaagaagcgc
cacattggcaacgactttgtcatggtggtgtacaacgactctggggaggagtacaagctg
ggaaccatcaaggggcagtttaactttgtggaagtcatcatcaaacctctggactacgat
tgtaacctggtcactttgcagtgccgcaaagacctggaaggtttggttgacacaacagtg
gcaaagatagtttccgaccgcaaccttcccctcctcgtgaggcagatggcgctgcatgca
aatatggcgtccttggttcatcagtacagagccaacccttcagacgcatatgcctccaag
tggctggccaggctacggcatataaagaggatcagaaccagagctcaggaggacatccag
tctcgttccactcctggaatctcgcttacgcaaggccacgctcagcagaacaagtcattt
cagcagaacacgcccactcccaacccggaagcatccggccaaaggaaaagactggtgtcc
actgtggatgacttcaccgattttgtttga

DBGET integrated database retrieval system