KEGG   Oryzias latipes (Japanese medaka): 101168458Help
Entry
101168458         CDS       T02443                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
ola  Oryzias latipes (Japanese medaka)
Brite
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101168458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 101168458
NCBI-ProteinID: XP_023811762
LinkDB All DBs
Position
6
AA seq 698 aa AA seqDB search
MANHCLTSNVDLRSRENNSSHRTKEIDRDRLIVRRGQPFSVAVQICDSTVQNGQLELVLH
LGKRDEVMIKVQRESGGADHWWFSQQAAQDEVMLTLHSPADAIIGQYRLAVLVMSPDGHI
VQKIEGVSFHLLFNPWNKDDAVYLPEESHLQEYVMNETGIIYRGTSEYISSIPWNYGQFE
DNIMDICFEVLDNSREALKNSKMDMECRADPVYISRIITAMVNANDDHGVLFGSWTPPYS
NGVAPSKWTGSVPILRQWSSTRARAVKYGQCWVFAGVACTVLRCLGIPTRLITNFCSAHD
VDGNLCVDVVDTFNSRQDSTWNFHCWVESWMRRDDLPKGNDGWQILDPTPQERSDGVFCC
GPCPVTAIKEGNLQVKYDAPFVFAEVNADITHWRVLPNGQRQKVYVDQKSVGRKISTKSV
YGDFREDLTVLYKYPEGSKEERTVFQKAGRRVTQPTNESTEPPQLQLLIKHARPVFGSDF
DVIAEVRNDGDEDAQVQLTVLATGVTYNSVHQGECQRQMIRVTVAAHEGHREVLRLRYKD
YAECTSEHHLIRVKAFAEAQGQNQPLMTVADVPLSVPELLVQIQGKAAVKQQVTAKISFT
NPLPVPLKGGVFTVEGAGLLSATQIHVKGEILPGQRVEVSFPFSPIRTGVRKLLVDFDSD
RLMDVKGTATLVVRKITGNYIRGISGIFGNLALTDPFV
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaccactgtttgacttccaacgtggacctgagaagccgtgaaaacaactcctct
caccgtacgaaggaaatcgatcgggatcgtttgattgtccgcagaggccagcccttctca
gtcgcagtacagatctgcgactctacggtgcagaacggccaactggaactggtcctgcac
cttggaaagagagatgaagtcatgatcaaggtccagagggagagtggtggtgcagaccac
tggtggttttcccagcaggcagcgcaggatgaagtgatgctgacgttgcacagcccagcg
gatgctatcatcggccaataccgtcttgctgtgctagtgatgtcacccgatggacacatt
gtccaaaaaatagagggagtcagcttccacctgctgttcaacccttggaacaaagatgat
gctgtatacctgcctgaagaatctcatctgcaggagtacgtgatgaacgagactgggatc
atatacaggggtacctcggaatacattagcagtattccttggaattatgggcagtttgaa
gacaatataatggacatttgctttgaagtcctggacaactccagagaagccctgaagaac
tcaaagatggacatggaatgcagagctgacccggtgtacatcagcaggattatcactgcg
atggtcaatgccaacgatgatcacggcgtgttatttgggagctggacaccgccgtactct
aacggagttgctccgagtaaatggactggcagtgtccccatccttcggcagtggagcagc
accagagccagagcagtgaagtacggccagtgctgggtgtttgccggtgtggcgtgcaca
gtcttgcgctgtctgggaatccctacacgcctcatcacaaatttctgctcggctcatgac
gtggatgggaacctctgtgtggacgtagtagacacctttaacagccggcaggacagcacc
tggaactttcactgttgggttgagtcctggatgaggagagatgatcttccaaaaggaaac
gatggttggcagattttggacccgaccccgcaggaaagaagtgatggcgtgttctgctgt
ggtccatgtccagtgacggccattaaggagggaaacctgcaagtgaagtacgacgctccc
tttgtattcgcagaggtcaatgctgatatcacacactggagggtcctaccaaacggccag
cgacagaaggtatacgttgaccagaaatcagtgggaagaaaaatcagcactaaaagtgtt
tatggagacttcagagaagatctcactgtgctctacaaatatcctgaagggtccaaggaa
gagcgcaccgtgtttcagaaagcggggcgtcgagtcacacagccgactaatgagagcaca
gaacctccacaactgcagctgctcatcaaacatgcaaggccggtttttggatccgacttc
gatgtgatcgcagaggtgagaaacgacggagacgaagatgcccaagttcagctgacggtg
ctggccacaggtgtgacgtacaactctgtccaccagggggagtgccagaggcagatgata
agggtgacggtggcagctcatgagggccacagagaagtgctgcgtctgcgctacaaggat
tatgccgagtgcacctccgagcatcacctaatcagggtgaaagccttcgccgaggctcag
gggcagaaccaacccctcatgactgtggccgacgtcccactgagcgtccctgagctgctc
gtacagattcaggggaaggctgcggtcaagcaacaagtgactgctaagatctccttcacc
aaccctctgccagttccactgaagggtggtgttttcacggtggagggggcaggcttgcta
tcagcgactcagatccatgtgaaaggggaaatcttaccggggcagagagtggaggtaagc
ttccccttctcccccatcaggacgggtgtgaggaagctcctggtggactttgactcagac
agactgatggatgtgaagggaaccgccactctggtcgtccggaagataaccgggaattac
atccgaggaatttcgggtatttttggaaacttagctttgactgacccgttcgtctga

DBGET integrated database retrieval system