KEGG   Oryzias latipes (Japanese medaka): 101168864
Entry
101168864         CDS       T02443                                 

Definition
(RefSeq) p53-induced death domain-containing protein 1 isoform X1
  KO
K10130  leucine-rich repeats and death domain-containing protein
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101168864
   04115 p53 signaling pathway
    101168864
SSDB
Motif
Pfam: LRR_8 LRR_4 Peptidase_S68 ZU5 Death LRR_6
Other DBs
NCBI-GeneID: 101168864
NCBI-ProteinID: XP_011474357
UniProt: H2LPC6
LinkDB
Position
6
AA seq 1004 aa
MERGGEGDQSSDEEEGGVQAAAQNTQQNELEDGEKVAAPAANPLSTPTEAQRERGTLSNG
AQENCEEAGVSMSRDLMLKSQAGAFDPENYDKSASPSSLLGTCDPSISNSSSTSCSFSHH
DMVLSCSSSSSHSSGLSLSPPLPSTVELSAVLTDTRLTLDVYPGGAGALPLLWGSIPAEL
RGIQYLRLGSEDRSGLDGALNVLSNLTELRSLAIRGHRLYDSKGTPLPGLLTTLPSSVSS
LTHLVHLDLSFNQLSCLPPCLLSLPLLSSLLLCHNFISALPPEICQLSSLTYLSLLGNML
ESLPPSLSQLKTLQELDVSHNLLQKLPEETGGLSELVKLDLSHNKLKQLPESMGSLCSLR
ELVIYSNHLRMVPSCLNKLPQLKIDARDNPLGKPPTPPPLPPTLGRSVTEMPELHLGFNQ
HSFWVTPAGCHVFLPGGAELVFPCRCLLTTTRLSWAEKRPNRKWVWLEEHDLLLSRPLEL
RPHGVEFLKPVEVCVPYHRRKRREVVVRRFDGELWSTLAADVRRGSQNNCCHPGGHPVRL
ACCSVRSFSWFMAVGRPVLDTCSVTPAETLLVSSADPGIKLHFPPDSTAQTRSVTLQVLQ
VSESTVQTLCGDPQARVSPLLCLSQNPCLHFLQPVKVQIPLPSGLTGHTMDLSCLHLLHG
DPAAQTWTDITSQVSLYVTHLYAIFYITHFSWYWLWYTTQRCVSGVVRKVYQRLKQFKVQ
FLVLQRRTDPSQVLLQCLPTNKVESRVKFLSEQYDGPQPSDLCDLLEGEQFFAGFERGLD
ISTDSPDCVSGRLCFVFYSSLKNLKEVYICPVQGQTGPVRGQVSFYRGDIPSNLPEEVAK
KRKGLDSQWLATLPLRLPALNSDNSFILDEQQYPPLNLGDPESGYLTEANLLSISLQIGQ
DWRVIGINLGLSYQELERIEYKHSKNLGALVLHMLFHWAHRQKSAGPGAVSRLTAAMIES
GRRDLAEEIEDIVNIGRRKYSESLRRVGLEAEELLEITSAANTN
NT seq 3015 nt   +upstreamnt  +downstreamnt
atggagagaggcggcgaaggagaccaaagttctgatgaagaagaaggtggggtccaggcg
gctgctcaaaacacgcaacagaatgagttggaagatggagagaaggttgctgcaccggca
gccaacccgttaagtacaccaaccgaagctcaaagggagcggggaacactttcaaacggg
gctcaggagaattgtgaggaggctggagtcagtatgtcacgtgatttgatgcttaaaagc
caagcaggagcttttgatccagaaaactatgacaaaagtgcatctccctcaagccttttg
ggtacttgtgatccatccatatcaaactcttcatccacctcttgctccttcagccatcac
gatatggtgctttcatgttcctcctcatcctcccattcttctggcttgtctctgagtcca
ccattgccctccaccgtggagctctcggctgtgttgactgacacgagactgaccctggat
gtgtaccccgggggagcaggtgcattgccattgctatgggggtccattccagccgagctg
aggggcatccagtacctgaggcttggttctgaggacagatccgggctggacggtgccctg
aatgtgctgtcaaacctgacagagctgcgctcacttgctatccggggacaccgtctgtat
gactcaaaggggacgcctctgcctggcctcctcaccactttgccatcatctgtgtcttct
ctcacacacctggtgcacctggacctctccttcaatcagctgtcctgtctgccgccctgc
ctgctgagcctgcctctgctctcctcactgctgctttgtcacaacttcatctcggcgttg
cctcctgagatatgccagctgtcctctctaacctacctctccctcctggggaacatgttg
gagtcccttcctccaagtttaagtcaactgaagacactgcaggaacttgacgtgtcgcac
aacctcctgcaaaaactacctgaagaaaccggtggtctgagtgagcttgtaaagctggac
ttgtcccacaacaaactaaagcagcttccagagagcatgggatctctctgttctctcagg
gaacttgttatatacagcaatcacctccgtatggttccatcgtgtctaaacaaactgcct
cagcttaaaatagatgcacgagacaatcctttgggaaaacctccaacacctcctcctctc
cctcctacactgggtcgatcagtgacagaaatgcctgagttgcaccttggatttaatcag
cacagtttttgggttactcctgctgggtgtcatgtatttcttcccgggggggctgagctg
gtgttcccctgccgttgcctgctgacaactactagactgagctgggcggaaaagaggcca
aacaggaagtgggtgtggctggaggaacacgacctcctactaagtcgtccactggaactt
cgtccccacggtgttgaatttctgaagccggtggaggtgtgtgtaccgtatcatcgaaga
aaaagaagagaagtagtggtgcggaggtttgatggagagttatggagtactttagctgct
gatgtgaggagaggaagccagaacaactgctgccatcctgggggccatccagtcaggctg
gcatgctgttcggtgaggagtttctcctggtttatggcggtgggcagaccagttttggac
acttgctccgtcacacccgccgaaaccctgctggtttccagcgctgatcctggaatcaag
cttcactttcctcctgactccacagcacagactcgctcggtgactttgcaggtgctgcag
gtttctgagtcaacagtccagactctgtgtggcgaccctcaggccagagtgagccccctg
ctctgcctctcccagaatccctgcctgcatttccttcagccagtcaaagttcagatccca
ctcccatctggcctcacaggccacacaatggatctgtcctgcctgcatctgctccacgga
gatcctgctgcccaaacatggaccgacattacgtcccaggtgtctctctatgtcacccat
ctgtacgccatcttctatatcacccacttttcgtggtactggctttggtataccacacag
cgctgtgtcagtggggtggtcaggaaggtttaccaacgcctaaaacaattcaaagtccag
ttccttgtgcttcagaggaggactgatccctcccaggttctgctgcagtgtttgcctacg
aacaaggtagagagcagagtgaagtttttatcagagcaatatgatggcccccaaccctct
gacctgtgtgacctgctggaaggcgagcagttcttcgctggctttgagagaggtttagat
atcagcacagacagtccagattgtgtcagcggacggctttgttttgtgttttactcgagc
ctcaagaacctgaaggaggtgtacatctgtccagtccagggtcagacgggacctgtgagg
ggacaggtgtctttctacagaggagatattcccagcaatcttccagaggaagtggccaaa
aagaggaaaggacttgacagccagtggctcgccacgctcccgttaagacttccagcccta
aactcggacaacagcttcatcttggatgagcaacagtatcctcctctgaacctgggtgac
cctgagagcggttacctgacagaagccaacctgctgtcaatctctcttcagattggtcag
gactggcgtgttattggcatcaatcttggcttaagttaccaagagctggagcgcattgaa
tacaaacacagcaagaacctgggcgccttggtgctgcacatgctgtttcactgggcccac
cggcagaagagtgcggggcctggggcagtgtcccgacttacagccgctatgatagagagt
ggcaggagggacctggctgaagagattgaggacatcgtcaacataggaaggagaaaatac
tcggagtcgctgaggagagtcggccttgaagcagaggaattacttgaaataacttcagca
gcaaatacaaattag

DBGET integrated database retrieval system