KEGG   Oryzias latipes (Japanese medaka): 101168897Help
Entry
101168897         CDS       T02443                                 

Definition
(RefSeq) glutamate decarboxylase 1 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00250  Alanine, aspartate and glutamate metabolism
ola00410  beta-Alanine metabolism
ola00430  Taurine and hypotaurine metabolism
ola00650  Butanoate metabolism
ola01100  Metabolic pathways
Module
ola_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    101168897
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101168897
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101168897
   00430 Taurine and hypotaurine metabolism
    101168897
Enzymes [BR:ola01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     101168897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Chlam_OMP3
Motif
Other DBs
NCBI-GeneID: 101168897
NCBI-ProteinID: XP_020566532
LinkDB All DBs
Position
17
AA seq 583 aa AA seqDB search
MATSEPRATGGDQDPNSANLRPPSATNEYAWMHGCTRKLGMKICGFLQKNNSLDEKGRLA
GHKNLLSCDNSGRESWFRRTETDFSNLYARDLLPAKNGEEATMQFLLEVVDILTNYVKKT
FDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGVRTGHPRFFNQL
SSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREMIGWPAGEGDGLFSPG
GAISNMYSVMIARYKYFPEVKTKGMSAAPRLVLFTSEHSHYSIKKAGAALGFGTDNVILL
STDERGRVIPADLEAKILDVKQKGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLNGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLY
NKINNREGFQMVFDGVPQHTNVCFWYVPPSLRGMSDSEERREKLHRVAPKIKAMMMESGT
TMVGYQPQGNKVNFFRMVVSNSAVTQSDIDFLVDEIERLGQDL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggccacatctgaaccgagagccaccggcggagaccaggaccctaattcagccaattta
agacctccatcggcaaccaacgaatatgcgtggatgcacggatgcacacggaaactgggg
atgaagatttgcgggttcctgcagaagaacaacagtctggacgagaaaggcaggctggcg
ggccataagaaccttctctcctgcgacaatagcggcagggagtcctggttccgccgaacc
gagactgacttctccaacctttatgccagagatcttttgccggccaaaaatggcgaagag
gccaccatgcagttcctgttggaggtggttgacatcctcaccaactatgtgaagaaaaca
tttgaccgctccaccaaggtgctggacttccaccaccctcaccagctccttgagggcatg
gagggcttcaacctggagctgtccgaccagccagagtccctggagcagatcctggtggac
tgcagggacacgctcaaatatggagtccggacaggccacccacgtttctttaaccagtta
tcttctggtttggacatcattggattggctggagagtggctcacttccactgccaacacc
aacatgttcacctacgagatcgctccagtattcgtgctgatggagcagctgactctgaag
aagatgagggagatgattggctggccagcaggagaaggagacggcctcttttctccaggt
ggtgctatctccaatatgtacagtgtgatgatcgcacgctacaagtatttccccgaagtt
aaaaccaagggcatgtctgctgctccccgccttgtccttttcacatctgaacatagccac
tattccataaagaaggctggagctgccctgggctttgggacagataacgtaatcctgctg
agcacagatgaaagaggaagagtcatacctgcagatctagaagccaaaatccttgatgtg
aagcagaagggttacgtacccctctttgtgaacgccacagccggctccacggtgtacggt
gcgtttgatcccatcaatgagattgctgacatttgtgagaagtacaacttgtggcttcat
gttgatggtgcatggggaggcggactactgatgtccaggaagcatcgccataaactcaat
ggagttgagagagcaaactcagtcacgtggaatccacataagatgatgggcgtccctctg
cagtgttcagccatcctggtcagagagaagggaatcctggcaggatgtaattccatgtgc
gctggctacctgttccaaccagacaaacagtacgatgtcacctatgacacaggggacaaa
gccatccagtgtggcagacatgtggatatctttaagttctggctaatgtggaaagccaag
ggcaccatcgggtttgagcagcacattgacaagtgtttggacctttcccagtacttgtac
aacaagatcaataacagggaggggtttcagatggtgtttgatggagtgcctcagcacaca
aacgtttgcttctggtacgtcccacccagcctgagaggaatgagcgacagcgaggagagg
cgggaaaaactccacagggtggcaccaaagatcaaagccatgatgatggagtcagggacc
accatggtgggctaccagcctcaaggaaataaagtcaacttcttcagaatggtggtgtcc
aactcggcagtcacacagtctgacatcgatttcctcgtcgatgagattgaaaggctgggc
caagatctgtag

DBGET integrated database retrieval system