KEGG   Oryzias latipes (Japanese medaka): 101169174Help
Entry
101169174         CDS       T02443                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00052  Galactose metabolism
ola00500  Starch and sucrose metabolism
ola01100  Metabolic pathways
ola04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101169174
   00500 Starch and sucrose metabolism
    101169174
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101169174
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ola04147]
    101169174
Enzymes [BR:ola01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101169174
Exosome [BR:ola04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101169174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101169174
NCBI-ProteinID: XP_004066105
LinkDB All DBs
Position
1
AA seq 971 aa AA seqDB search
MVSYKRLNPEDVQFSSELLSEEPRGTQENAAVAEPEGTFLLPHRPSCSITKALLVVGCLL
LLLVGGWLIVTMFWLHSPSNQQPHKPPSPAPQPTSSSQTELNDTSSAARIEACSAISEPW
RFDCYPERGVVVTKDMCEARNCCFIPASSSSNAGQSRKNGVPWCFYPPDFPSYSLVSTDD
TLMGQKGTLVKEVKTYYPGDILTVEVETRQETDTRLHVRMTDPSNPRFEVPISVPNPTKK
AENPAYIVELSKQPFGITVKRRSTGVLLLNTTVAPLFYADQFLQFSTVLPTQFIYGLGEH
RSTFLHDMNWNTLTMWARDVPPMEKTNLYGVHPFYLAMEEDGNAHGFFLLNSNAMDVVLQ
PTPALTWRTIGGILDFYVFLGPDPGSVVSQYLEVIGNPAMPIYWALGYHLCRWGYNSSNS
TWEVVKSLRNYGIPQDTQWNDIDYMDQSMDFTYDSKKFETLPDLVRDLHAHNQTYVIMLD
PGISSTQPEGSYWPFDEGLKRGVFIKDAEGKTLIGKVWPGLTAYPDFSDEVTHDWWFDNL
QKFHNKVPFDGLWIDMNEPSNFLDGSTNGCPSNSLENPPYTPGVLGGLLRAKTVCATAQQ
KLSMHYNLHSLYGLMEAKASASALKKLLTKRPFVISRSTFPSQGLYSGHWLGDNRSQWKD
LYTSIAGILTFNLLGIPLVGADICGFSEEPQEELCVRWTQLGAFYPFTRNHNSIDMKPQD
PTAFSPLARTAMKEALLLRYSLFPFLYTLFHHAHAHGHSVARPVMFEFPKDVKTYGIDKQ
FLWGRSLLVTPVLDPGVDYVVGYFPAGLWYDFYTGDSLHSKGEEVRLQAPLDKINLHLRE
GSVIPTQTPNLTLWISTGQPLHLISALSDEGSAHGDLFWDDGESIDTFETNQYSYIVFSV
AQNTMTSQVLKSHQEASFITVGSASFYGVSAKPSKVLVNSKDHPFTYRDRQVLTVSDLNL
NLVQNFTISWT
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcatacaaacggctgaacccagaagatgtccagttttcctctgaacttctgtct
gaagaacctcgtggaactcaagaaaatgcagcagtagcagagccagaggggacattcttg
ctcccacacagaccatcgtgctcgatcaccaaggctcttctggttgttggttgcctcctg
ttgcttctcgttggaggctggctgattgtgactatgttctggcttcacagtccttccaac
cagcagccgcacaaaccaccatccccagctccacagccaacatcaagctcccaaactgaa
ctaaatgacacttcaagtgccgcccggattgaagcttgcagtgcgatctcagagccgtgg
aggtttgactgttaccctgaaagaggcgtggttgtaactaaagatatgtgtgaggcgaga
aactgctgtttcatccctgcatcatcatcatctaatgctggacagtcgaggaaaaatggt
gtcccttggtgtttctaccctccggatttcccatcgtactcactggtatcaacagatgac
acactgatggggcagaaaggtactcttgtaaaagaggtgaagacttactacccaggagac
atccttactgtggaggtagaaacacggcaggagacagacactcggttgcatgtcaggatg
accgacccttcaaatccacgttttgaagttcctatctcggttccaaaccccaccaagaag
gcggagaatcctgcatacatcgtggagctctccaagcagccgtttggcatcaccgtgaaa
aggagatctactggagttctgcttctgaataccactgtggctcctctcttctatgcggac
cagttccttcagttctccaccgttctccctactcagttcatttatggtctgggggaacac
cgctccaccttcctgcatgacatgaactggaacactctcaccatgtgggccagagatgtg
ccccccatggaaaaaacaaatctttatggagtccatcctttttatcttgcgatggaggaa
gacgggaacgctcatggtttcttcctgctgaacagtaatgcaatggatgtggtcctccag
cctactcccgctctcacctggcgcaccatcggtggaatcctggacttctatgttttcctc
ggtcctgatcctggatcggtggtttcgcagtatttggaagtgatcggaaatccagcaatg
cctatctactgggcgttaggatatcatctgtgtcgctggggctacaacagcagtaactct
acctgggaggttgtgaagagcctgaggaactatggaatacctcaggacacccagtggaac
gacatcgactacatggaccagtccatggacttcacttatgactctaaaaagtttgagaca
ctcccggacctcgtcagggaccttcatgctcataatcagacctatgtcataatgctggac
ccgggcatcagcagcacacagcctgagggctcatactggccgtttgatgaggggctgaaa
aggggagtttttatcaaggatgctgaaggaaaaacacttataggaaaggtgtggcccggt
ctgacggcgtaccctgacttctctgatgaagtgacacacgactggtggttcgacaacttg
cagaagttccacaataaagtgccgtttgatggattatggatcgacatgaatgagccgtct
aactttctggatgggtcgaccaatggctgtccgtcaaacagtttggaaaaccctccctat
actccaggcgtgctgggaggtttactgcgggccaaaacagtgtgtgccactgctcagcag
aaactgtccatgcattataatctacacagtctctatggccttatggaagctaaagcctct
gcaagcgctctaaagaaacttttgacgaagagaccgttcgtgatctctcgctccaccttc
cccagtcagggtttgtattctgggcactggctgggagacaacaggagccagtggaaagac
ctttacacttcgattgcaggtatcctgacctttaaccttctaggtattcccctggtgggg
gcagacatctgtggttttagtgaggaaccacaagaagagctgtgtgtcaggtggacacag
ctgggggccttctatcccttcacccgaaaccacaattccattgacatgaagcctcaagac
ccgacagctttcagcccgctggcacggacagccatgaaagaggctctgctgctgcgctac
tctctcttccccttcctctacacactctttcatcacgcacacgcacatggacactctgtt
gcccggcccgtaatgtttgagttcccaaaagatgtcaaaacatatgggatcgataaacag
ttcctgtggggaaggagtctgttagtgacaccagttctggatcctggagtcgactatgtg
gttggttactttccagcaggtctgtggtacgacttctacacgggggactccctgcacagc
aaaggagaagaagtacgtctccaagccccactggataaaatcaacctccatttgcgtgaa
ggctctgtgatcccaacacagaccccaaaccttaccttgtggatcagcaccggccagcct
ctccatctaatctctgctctgtctgacgagggttcagcccacggggatctgttctgggat
gacggggaaagcattgatacctttgagaccaatcaatactcctacattgtcttcagcgtt
gctcagaacacgatgacgtcccaagttctcaagagccaccaagaagcctcatttataact
gtgggatccgcctccttctatggtgtcagtgcaaagcccagcaaagttctggtgaactcc
aaagatcatccgttcacctacagagacagacaggtgttgacggtctctgatctgaatctc
aaccttgttcagaacttcaccatcagctggacctaa

DBGET integrated database retrieval system