KEGG   Oryzias latipes (Japanese medaka): 101169423
Entry
101169423         CDS       T02443                                 

Gene name
steap3
Definition
(RefSeq) metalloreductase STEAP3 isoform X1
  KO
K10142  metalloreductase STEAP3 [EC:1.16.1.-]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101169423 (steap3)
   04115 p53 signaling pathway
    101169423 (steap3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101169423 (steap3)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.1  With NAD+ or NADP+ as acceptor
    1.16.1.-  
     101169423 (steap3)
Membrane trafficking [BR:ola04131]
 Exocytosis
  Others
   Others
    101169423 (steap3)
SSDB
Motif
Pfam: F420_oxidored Ferric_reduct NAD_binding_2 2-Hacid_dh_C IlvN Shikimate_DH UPF0114 XdhC_C Glyco_trans_4_4
Other DBs
NCBI-GeneID: 101169423
NCBI-ProteinID: XP_020564407
LinkDB
Position
2
AA seq 491 aa
MPDEMSRPLVPGWSESGGSRQLEASLSDPNTPTIGILGTGDFSRSLARRLVASGYQVVVG
SRSPARSVALFPEEVEVSSQMEAATQADVVFVAVFPEHHSTLVTLKSALAGKTLVDVSNS
LGINRDGPSNAEHLSNLFPDSFVVKGFNTLSAWTLQMGPRHGIRQVPLCGNSSKAKDLVK
HICHRMGFIPVDMGFLSSSLEVENLPHHLFPSWRIPVLCMLCLFIFFYLYNFIQEVIHPL
VKTGKGAFYKMPIEVVNASLPSVALVMLALVYLPGLFAAFIQLQWGTKYKRFPDWLDRWL
TARKQFGLCSFLCAVTHAVYSLSLPLRKSARYKLSNMAYQQVKAGVEDSWNDEEVWRMEL
YVSAGIMALGLLSLLAVTSLPSVANTLNWREFTFIQSSLGFCALVTATAHTLIFGWNRAF
AAARYPFYLPPSFVLVLILPCFVLCGRLALLLPCVAARLWKIRRGWERSRQIRFALPGED
CRNGVEDVSNV
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgccggacgagatgtcacggccactggtcccagggtggagtgaatcaggaggctccaga
cagcttgaggcctccctgtcggaccccaacacccccacgatcggcattctgggaacaggt
gacttctcccgctcgctggccaggcgactggtggcttctggttaccaagtggtggtgggg
agccgaagccccgctcggtctgtggctctgttcccagaggaggtcgaggtgtcatcccag
atggaggcagcgacccaggcggatgtcgttttcgtcgcagtatttccagagcaccactct
acgctggtgaccctgaagtccgctctggccgggaagacgctcgtggacgtcagcaacagt
ttaggcatcaaccgagacgggccgtccaacgccgaacacctctccaaccttttcccagac
agttttgtggtgaaaggcttcaacactttatccgcctggacgctccagatgggaccgcgg
catggaatcaggcaggttcccctgtgtggcaacagtagtaaggccaaagacttggtgaag
cacatctgtcacaggatgggcttcatccctgtggatatgggcttcctgtcatcttccctg
gaggtggaaaacctcccacaccatctgttcccttcatggcggatccctgtcctctgcatg
ctgtgccttttcatcttcttctacctgtacaacttcattcaggaagtcattcacccctta
gtcaagacgggaaagggcgccttctacaaaatgcccatcgaagttgtcaatgcgtctctt
ccatcggtggcgctggtgatgctggccctggtttaccttccaggcttgtttgccgccttc
atccagcttcagtggggcaccaagtacaaacgcttccccgactggctggaccgatggctc
accgcgaggaagcagtttggcttgtgtagtttcctgtgtgccgtcacgcacgccgtttac
agtctcagtcttcctctgagaaagtccgcccgctacaaactctccaacatggcttaccaa
caggtcaaagctggggttgaggattcatggaacgacgaggaggtgtggaggatggagctg
tacgtctctgccggcatcatggcgctcgggctgctctcgctgttggccgtcacctcactg
ccgtcggtggccaacaccctcaactggagggagttcaccttcatccagtcgtctctgggt
ttctgcgccctggtcaccgccacggcccacacgctcatttttgggtggaaccgcgccttc
gccgcagctcgctaccccttctacctgcccccgagcttcgtcctggtcctcatcctcccc
tgctttgtcctgtgcggacgcctggctctcctcctgccctgcgtggccgcccgtctctgg
aagatccgccgcgggtgggagaggagccggcagatccgcttcgccctgccgggggaagac
tgccgcaacggagtggaggacgtcagcaacgtttga

DBGET integrated database retrieval system