KEGG   Oryzias latipes (Japanese medaka): 101169559
Entry
101169559         CDS       T02443                                 

Gene name
adgrb1
Definition
(RefSeq) adhesion G protein-coupled receptor B1 isoform X1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101169559 (adgrb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ola01002]
    101169559 (adgrb1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101169559 (adgrb1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ola04030]
    101169559 (adgrb1)
Peptidases and inhibitors [BR:ola01002]
 Mixed peptidases
  Family P2
   101169559 (adgrb1)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Phagocytosis
   Others
    101169559 (adgrb1)
G protein-coupled receptors [BR:ola04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   101169559 (adgrb1)
SSDB
Motif
Pfam: 7tm_2 AGRB_N TSP_1 GAIN TSP1_spondin TSP1_ADAMTS GPS TSP1_CCN
Other DBs
NCBI-GeneID: 101169559
NCBI-ProteinID: XP_023819596
LinkDB
Position
16
AA seq 1587 aa
MANIFFLPGQARWPFPVLLLYFVPLLPMRSWGQVVPSTLDFDSCSTLVQNRFFGYFLSSS
VFPTVPCSWTLQNPDRRRYTIFIKLTKPTNDCVPSQLRTFQYDSLLETTQSYLGMESFDE
VVGLCDASVPVAFLEAGKQFLQIRKGPPRAGTPTPRTSGDFKTEYLVVGKRNPSMAACQM
LCQWLEDCLASSTSNRPCGIMQTPCLCWEPPPQLSQADNCYHNGLYLENCLPSIKDSGKV
DQSGGWSGWSSWAQCSSECGGGIQTRTRTCQSPPDEGFLCEGVVEEGRPCNSHSCSGKGL
HLSRSQSLRSVDSLKRDDVEKPRSGQKSPQTVESVSGEEWTAWSDCSATCGEGWQSRTRF
CVSSSYSTQCSGPLREQRPCNNSSVCPVHGAWDDWTPWSLCSSTCGQGQRYRTRTCTPPQ
FGGDPCEGPNKQNKFCNIAVCPVDGKWNEWAPWSFCSTTCSNGTMKRTRQCNPPSYGGSE
CKGEWQETIHCDLGECPVDGKWQPWSLWSSCTKTCGGGRQQRNRICFGPFFGGQPCPGER
EEVRPCNEKRCPEPHEICGEDNFSNVVWKMTPAGETAAVRCPPNAVGLILRRCTLDDEGI
AYWENPTYMKCISNDYRSIQTLTREHLSKAQRGLAGDGVSEVMTKLKVISSDGTSYSGDL
LAILDVLKNMTEIFRRAYYSLSSADMRNFVQSVSNLLMEENRERWEEAQLLGPSIKELFR
LLEDFVDVIGLRMKDFQDMYEVTDNLVLSIHKRPVMGHADITFPMKGWRGNVDWARSSED
RANIPKNILSTGKPDGDDSSAFVTGIVLYRNLGSIVTLQRNATVLNSRVLSVSIKPSPPS
LAAPVVVEFSHLYNGTSNQTCISWDESDSSSLLGSWSAKGCKAVLVDSFRTKCVCDRLST
FAILARLNPDMNMDKTQLPSVTLIVGCGVSSLTLLLLIIIYVSVWRYIRSERSVILINFC
LSIISSNALILIGQTQTRNKVLCTLIAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRI
IRKRFLCLGWGLPALVVAISVGFTKAKGYGTPSYCWLSLEGGLLYAFVGPAAAVVLVNMV
IGILVFNKLVSKDGITDMKLKERAGQMTVPLYNMTLKCAKCGVISSADVSTTATSNAMAS
LWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQEAV
KCRVVDRHEDTNGDSGGSFQNGHAQLMTDFEKDVDMACRSGTTKRASLQGDDKASSGTLK
LQKNANFNTMPANMAKVHLQIVADYTSHTLTLRREKGAAKGISTELPGAKSVYVHEGELL
KQLDGDLPRGTGEGSSSEGTGKGPGYIILPTNNTGTLKPVKGKEDQTAKYSAEQLPQTRL
IHLANPAVVEPVPGFGMKSLPADQVSVPCSDRDSPAHLQGKPRDPQLSGLCDGGQSGSSG
VMSKGETVSTLSMSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKIHSADKDRESPP
VDAKASKRWSVSSASSDKTNMSQDKQSTPSKRAWEGIRKAHSPPSWVRKDLETVAASPLE
RQTVEWEKTGATIPLVGQEIMDLQTEV
NT seq 4764 nt   +upstreamnt  +downstreamnt
atggcaaacatatttttccttcctggccaagcaaggtggccttttccagtgctgcttttg
tactttgttcctcttcttccaatgaggagttggggtcaggttgtaccctctactttagat
tttgattcctgctccactttagtccagaaccggttctttgggtattttttatcttcatct
gtgtttcccactgtgccttgttcttggaccctgcagaacccagatcgacggcgctacacc
atcttcatcaagttgaccaagcctactaatgactgtgtgccctcacaactgcgcacattc
cagtatgattccttactggagaccacacaaagctaccttggcatggaaagctttgatgaa
gtggtgggtctgtgtgatgcctctgtcccagtggccttccttgaagccggaaaacagttt
ctgcagatcaggaagggacctcctcgggctggcacgccgactcctcgcaccagtggggat
ttcaaaactgagtaccttgtagttggcaaacgcaatccaagtatggcagcctgtcagatg
ctctgccagtggttagaagactgcctggcctccagcacatctaacaggccttgtggcatc
atgcagaccccttgtttgtgctgggagcccccaccacagctcagccaggctgacaactgt
tatcacaacgggctttatctggaaaactgcttacccagcatcaaagacagtggaaaggtt
gatcaaagtggtggctggagcgggtggagctcatgggcgcaatgcagcagcgagtgcgga
ggcgggatccaaacgaggactcggacctgtcagtcacctccagacgaggggtttctgtgt
gagggcgtcgtggaggagggccggccctgcaactcacactcctgctcgggcaaaggtctc
catctgtctcgcagtcagtcgctccgctcggtggacagccttaagcgggatgatgtggaa
aagccccgcagcggacagaagagccctcagacagtagagtcagtttcaggtgaggagtgg
acagcgtggagcgactgctctgccacatgtggggagggctggcagagccgcacgcggttt
tgcgtgtcctcctcctacagcacgcagtgcagtgggccgctgcgagagcagagaccctgc
aacaattcttctgtttgtccagtgcatggcgcgtgggacgactggacgccttggagcttg
tgttcgtccacctgtggccagggtcaaaggtaccgcacgcgaacctgcacccccccgcag
tttggtggggacccctgtgaaggaccaaataagcagaacaagttctgcaacatagctgtc
tgtccagtggatggaaaatggaacgaatgggccccctggagcttctgctccactacgtgt
tccaatgggaccatgaagaggacccggcagtgcaaccctccctcgtacggaggctctgag
tgcaaaggggagtggcaggagaccatccactgcgatctcggggagtgtccagtggacggc
aaatggcagccttggtccttgtggtcaagttgcaccaaaacgtgtggtggggggaggcag
cagagaaacaggatctgcttcggccccttctttggaggacagccgtgtcccggagaacga
gaagaggtccgcccctgtaacgaaaagaggtgtccagaaccccatgaaatctgcggtgaa
gataatttttccaacgttgtgtggaagatgacccctgcaggggaaaccgcagcagtccgc
tgtccccccaatgccgtgggtctcatcctccgccgctgcaccctggatgatgagggcatt
gcctactgggagaatccaacatatatgaagtgcatctctaatgactatcgcagtatacaa
actttgactcgagaacatctgtccaaagcgcagcgcggcctggcaggagatggagtttca
gaggtcatgaccaagctgaaggtcatctccagcgacggaaccagctacagcggggatttg
ctggccatcttagacgtgctgaagaacatgacagagatcttcaggagggcgtactacagc
ctcagcagtgcagacatgaggaactttgtgcagtcagtcagcaatctgctgatggaggag
aacagggagaggtgggaagaggcacagctgctggggcccagcatcaaagagctgttccgg
ctgctggaggactttgtggatgtcattggcctcaggatgaaagacttccaagacatgtat
gaagtcaccgataacctggttttgagcattcacaaacggcctgtgatgggtcacgctgac
atcaccttccctatgaaaggctggaggggcaacgtggactgggcccgcagctctgaggac
agagccaacatcccaaagaacatcctgtccacaggaaagccggatggagatgactcctcc
gcctttgtgaccggcatagttctgtacagaaacctgggcagcattgtgactctgcagaga
aatgcgactgtcctgaactccagagttctgtccgtgtccatcaagcccagccctccttcc
ctcgcagctcctgttgtggtggaattctctcacctttacaacgggacttccaaccaaacc
tgcatatcatgggacgagagtgacagctcctctctgctcggatcctggtctgccaaaggc
tgcaaagccgtgcttgtcgactcgttccgaaccaagtgcgtgtgtgacagactgtccacc
ttcgccattttagcccggctaaacccagacatgaacatggataagactcagctcccatct
gtgaccctgatcgtgggttgtggagtttcctcactcactttgctgttgctcatcatcatt
tatgtgtctgtctggaggtatattcggtccgagcgctctgtgatcctcattaacttctgc
ctttccatcatctcctccaacgccctgattctgattggacagactcagacgaggaataag
gtcttatgcaccctaattgctgcattccttcatttcttcttcctgtcttcattctgctgg
gtcttgacagaggcgtggcagtcatacatggcagtaacaggccgcctcagaaaccgtatc
atacggaagcgtttcctgtgtcttggctggggtcttcctgctctcgtagtagcaatttca
gtgggcttcaccaaagcaaaaggatatggaacaccgagctattgttggctgtctttggaa
ggaggtcttctctatgcatttgttggacctgctgcagctgtagtcttggttaacatggtt
attgggattctcgtttttaacaaactggtgtccaaagacggcataactgatatgaaacta
aaggagagggcgggtcagatgacagtgccactgtacaatatgacgctcaaatgtgccaag
tgcggggttatctcttcggctgacgtttccactacagctaccagtaacgccatggcgtcg
ctgtggagctcttgcgtggtgctgccgctcttggctctcacgtggatgtcggccgtcctg
gccatcaccgacagacgctctgcgctcttccagatccttttcgccgtctttgactcgctg
gaaggcttcgttatcgtcatggttcactgcattctgcgcagagaggtccaagaggcagtg
aagtgtcgtgtggtagaccggcatgaagacactaacggcgattcaggagggtcttttcaa
aacggccacgctcagctcatgacggactttgagaaggacgtggacatggcttgcagatca
ggaaccacaaagcgcgcatccctccagggggacgacaaggcctcatctggaaccctcaag
ctccagaagaacgctaactttaacaccatgccagccaacatggccaaggttcacctccag
attgtggctgactacacaagccacactctgacgctacgcagggaaaagggcgccgccaag
ggaatcagcactgagcttccaggtgcaaagtctgtgtacgtccacgaaggtgagctcctg
aagcagctggacggagatctgcctcgaggaactggtgaaggcagcagcagtgagggcaca
gggaaaggtccaggatacatcattctgccaacaaacaatacgggcaccttgaaaccagta
aaggggaaagaagatcagacagccaagtacagcgctgagcagcttcctcagaccaggctg
atacacctggcaaacccggcggttgttgaacccgttcccggctttgggatgaagagcctg
cctgctgaccaggtcagtgtgccctgctctgacagagactcgcctgcacatctgcagggc
aagcccagggatccccagctaagcggtttgtgtgacggcggacagtctggaagctctggg
gtgatgtccaaaggggagaccgtctccactctgtccatgagctctctggagagacgaaaa
tcccgatatgcagagcttgactttgagaaaataatgcacacccggaaacgccaccaggac
atgtttcaggacctgaacaggaagattcacagtgcagacaaggatagagaatctccacct
gttgatgccaaagcttccaaaagatggagcgtgtcctctgccagcagcgacaagaccaac
atgagtcaggacaagcaatcaacccccagtaaaagagcatgggagggcattcggaaggca
cattctcctccatcctgggtaaggaaagacctggaaactgtggcagcctcccctctggag
cggcagacggtggagtgggaaaagactggcgccaccattccactggtgggccaagagatc
atggacctgcagacagaggtgtga

DBGET integrated database retrieval system