KEGG   Oryzias latipes (Japanese medaka): 101169599
Entry
101169599         CDS       T02443                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
ola  Oryzias latipes (Japanese medaka)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 101169599
NCBI-ProteinID: XP_020558776
LinkDB
Position
5
AA seq 364 aa
MSWGEFIELRDLRSREQLELTGTRSPCSPPRLERTNALRISPGRVPDLLSRVGIIRVLSS
AHDPRIPEEKGEGHNFQPCSHAQPTWCDLCGDFIWGLYKQSLQCVNCRFTCHYRCRALIQ
LDCSSEHSSAVDYIGVVEHTIETDTNVDETTERGKQELSSAEIHQKVKEYNAQINSNLFM
NMNKDGSYTGFIKVQFKLARPVSVPAPKKGSQDACGRRASGVKRRTSFYLPKDASKYLHI
SSRTSAREVIEALLKKFTVVDNPGKFALFERSERHDQVYIRKLSDEERPLRLRLCSGPSE
KVLSFVLKENETGEVNWHAFSMPELKNFLLILQREEEEHVKQIIQRYALARTKMRDALAG
STPG
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcttggggggagttcattgagctccgtgacctgaggtcgagagagcagctggagctg
acgggcacgcggtcaccgtgctcacctccacgcctggagaggacgaatgccttaaggatc
agtccggggagggtcccggacctgctgagccgagtgggcatcatcagggtcctgagcagc
gcccatgacccccggatccccgaggagaaaggagaaggacacaacttccaaccctgcagc
cacgctcagcccacgtggtgtgacctgtgtggagacttcatctggggcctctacaagcag
agtctgcagtgtgtcaactgcagattcacatgccactaccgctgtcgtgccctgatccag
ctggactgtagctcggagcacagcagcgcggtggattacattggagtagtggagcacacc
attgagacagacacaaatgtggatgagacaactgaacggggaaagcaggagttgtcgagt
gctgaaatccaccagaaggtgaaggagtacaacgctcagatcaacagcaatctgttcatg
aacatgaacaaggatggctcctatactggcttcataaaggtgcagttcaagctggcgaga
cccgtatccgttcccgctccaaagaaaggaagccaagatgcttgtgggaggagggccagt
ggtgtgaaacgccgcacctccttctacctgccaaaggatgcctccaaatatctgcacata
agctcacgtacctctgctcgggaggttatcgaggcgttgctgaaaaagtttaccgtggtg
gacaatcctggcaagtttgccttgtttgagcgcagcgagcgtcacgatcaagtttatatc
cgtaagctgtctgatgaggagcgtccgttgcgtttgcgtctgtgctctgggcccagtgag
aaagtcctcagcttcgtgcttaaagagaacgaaactggtgaagtcaattggcatgccttc
tctatgccagagctgaagaacttcctgctcattctgcagcgtgaggaagaggagcacgtc
aagcagatcattcagagatacgctttagcgcgcaccaagatgcgtgacgctctagccggc
tctactcctggctga

DBGET integrated database retrieval system