KEGG   Oryzias latipes (Japanese medaka): 101169635Help
Entry
101169635         CDS       T02443                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00020  Citrate cycle (TCA cycle)
ola00190  Oxidative phosphorylation
ola01100  Metabolic pathways
ola01200  Carbon metabolism
Module
ola_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ola_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ola_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101169635
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101169635
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101169635
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 101169635
NCBI-ProteinID: XP_004077837
LinkDB All DBs
Position
16
AA seq 663 aa AA seqDB search
MASVRAASRLLSRRAISNIKAVPAAAVQNSRNFHFSIYGKKNNAKVSDDISTQYPVVDHE
FDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDDWRW
HFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEDGKIYQRAFGGQSLKYG
KGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGQCKGVIALCMED
GSIHRFRSQNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIY
GAGCLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVGPEK
DHVYLQLHHLPPQQLAARLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQV
IDYTDGKDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIASEHKPGEKL
SPLKPNAGEESVANMDKLRFASGSLRTSEIRLNMQKTMQNHAAVFRTGSVLKEGCDKMDD
IYQTLDQIKTFDRGIVWNTDLVESLELQNLMLNAVQTIHSAEQRKESRGAHAREDFKVRV
DEFDYSKPLQGQEKKPFDQHWRKHTLSYVDRKTGKVTLKYRPVIDTSLDEEDCAHVPPAI
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtgttcgcgctgcgtctcgtctcctttccaggagggcgatctctaatattaaa
gcagttcctgctgctgcagttcaaaattcaaggaactttcacttctccatctacggcaaa
aagaataatgccaaagtttcagatgacatatccactcagtatccagtggtggaccatgag
tttgatgcagtggtggtgggagccggaggagcggggctgcgggccgctttcggcctgtct
gaggccggctttaacactgcctgcgtcaccaagctcttccccaccagatcccacactgtt
gctgcacagggtgggatcaatgcggctctgggaaatatggaggatgacgactggaggtgg
catttctatgacacagtgaagggatctgactggcttggagaccaggatgctattcattac
atgacggagcaggctcctgctgctgtcgtggagctggaaaattttggcatgccgttcagc
cgcactgaggatgggaagatttaccagagagcctttggaggtcagagtctgaagtatgga
aaaggaggtcaggctcatcgctgctgctgtgtagcagacagaacaggtcactcgctgctg
catactctttatggaaggtcactccgttatgacaccagctactttgtggagtactttgct
ctggacctgctgatggaagatgggcagtgcaaaggagtgatcgctctctgcatggaggat
ggatctattcaccgcttcagatcccaaaacaccgtcattgccacaggaggctatggaaga
acctatttcagctgcacatctgcccacacaagcacaggagacggaaacgccatggtgacc
agagctggtctgccctgtcaggacttggagtttgtgcagtttcaccccactgggatctat
ggagccggttgcctgatcacagaaggctgccgtggtgaaggaggaatcttgatcaacagt
gagggagagcgcttcatggagcgttacgcccccaacgccaaagacctggcctccagggac
gtggtgtcccgctccatgaccatagagatcagggagggcaggggtgtcggtccagagaag
gaccacgtgtacttgcagcttcatcatctgcctcctcagcagctggccgcaaggctgccc
ggtatctcggagacggcaatgatctttgctggagttgacgtcaccaaagagcccatcccc
gtcctgcccacagtccactacaacatgggaggaatccccacaaactacaaaggacaggta
atcgattatacagatggtaaggacaaagtggtgcctggactttacgcctgcggtgaggca
gcttgtgcgagcgtccatggggccaacaggctgggtgctaactccctgctggacttggtt
gtcttcgggagagcctgtgccctcactattgctagtgagcacaaacctggagagaagctg
tcgcccctgaaacccaatgcaggagaggagtctgtggccaacatggacaagctccggttt
gccagtgggagtctgagaacctctgagatccgacttaacatgcagaagaccatgcagaac
cacgctgccgttttccgtaccggctcagtcttgaaagaaggatgcgataagatggacgac
atttaccagaccctggatcaaataaaaaccttcgacagaggcattgtgtggaacacagac
ttggtggaatcattggagctgcagaacttgatgctgaatgctgttcagaccatccactct
gctgagcagagaaaggagagcagaggagcccatgctagagaggacttcaaagttcgcgtg
gatgagtttgattactccaagccgctgcagggtcaggagaagaaacccttcgaccagcac
tggaggaagcacacactgtcttacgtcgaccgcaaaactggaaaggtgaccctgaagtac
cgtcccgtcattgacacctccctggatgaagaggactgtgcccacgttccccccgccatc
agatcctactaa

DBGET integrated database retrieval system