KEGG   Oryzias latipes (Japanese medaka): 101169672
Entry
101169672         CDS       T02443                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
ola04310  Wnt signaling pathway
ola04340  Hedgehog signaling pathway
ola04371  Apelin signaling pathway
ola04510  Focal adhesion
ola04530  Tight junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101169672 (ccnd1)
   04340 Hedgehog signaling pathway
    101169672 (ccnd1)
   04371 Apelin signaling pathway
    101169672 (ccnd1)
   04068 FoxO signaling pathway
    101169672 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101169672 (ccnd1)
   04115 p53 signaling pathway
    101169672 (ccnd1)
   04218 Cellular senescence
    101169672 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101169672 (ccnd1)
   04530 Tight junction
    101169672 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101169672
NCBI-ProteinID: XP_020567270
LinkDB
Position
3
AA seq 292 aa
MEEQLLCCEVDSIRRAHQDVNLLNERVLRTMLKAEENYLPAPNYFKCVQKDIAPNMRKIL
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTRKSRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVQPGELLQMELLVLSKLKWDLASVTPHDFIEHFLSKLTIHASTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDASLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHGSVTEAKRVDEEVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaggagcagctgctgtgctgcgaggtggactccatccggagagcccaccaggacgtc
aacctgctgaacgagcgcgtcctgcggaccatgctgaaggcggaggaaaactacctgccg
gcgcccaactacttcaagtgtgttcagaaggacatcgctcccaacatgaggaagattctg
gccacctggatgttagaggtctgtgaggaacagaaatgcgaggaggaggtttttccgttg
gcaatgaactatttggacagatttttatcagtggagcccaccaggaaaagcagactccag
ctgcttggagctacatgcatgtttctggcatctaagatgaaggagacggtaccattgact
gcagagaaactctgtatctacacagacaactcggtccaacctggagaactgctgcaaatg
gagctgctggttctcagcaagctgaaatgggatctggcttctgtcacacctcatgacttc
atcgagcacttcctgtccaagctgacaatccacgcatcgacaaagcagatcctcaggaaa
cacgcccagacctttgtggctctctgcgctacagatgtgaactttatagccagtcctcca
tcaatggtggcagccggcagtgtggtggcagctgttcaaggactctacttgaaaagccaa
gatgcctccttgtcctctcagaacctgactaacttcctgtctcaggtcatccgcagtgac
ccggactgtttgcggtcgtgtcaggagcagattgagtctctgctggagtccagcctgcgg
caggcgcagcagcatggcagcgtgacggaagccaagcgtgtggatgaagaggtggacctg
tcctgcacgccaacagacgtgcgggacatcaacatttga

DBGET integrated database retrieval system