KEGG   Oryzias latipes (Japanese medaka): 101169862
Entry
101169862         CDS       T02443                                 

Gene name
trpv4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101169862 (trpv4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ola04040]
    101169862 (trpv4)
Ion channels [BR:ola04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   101169862 (trpv4)
SSDB
Motif
Pfam: Ank_2 Ion_trans Ank Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 101169862
NCBI-ProteinID: XP_020561608
LinkDB
Position
9
AA seq 871 aa
MNEGRSALLRRCHLAFSRADTLGSAGSAASEDCKEGDAAQAEGEAAFPLSELSQLFESED
GSQSAQDTSQESALELVQPGNPADSRQNLRTKFQGAFRKGISHPMDLFEATIYESNVVPA
PKKAPMDSLFDYGTYGNSSNQKKRRKKLPRGKTEASCDIVPNPDPPKVMKIFNRILLFDC
VSRGDPEDLEGLLEYLQVHEKRLTDEEFREPSTGKTCLPKALLNLYGGRNNTIPLLVDIA
EKTGNLREFINTPFRDVYYRGQTALHIAIERRCKHYVELLMEKGADVHAQARGRFFEPKD
EGGYFYFGELPLSLAACTNQPNIVNYLTENPHKKADLRRQDSRGNTALHALVHIADNTKD
NTRFLTKMYDLLLIKCTKLYPECNLEKMANNDGLTPLMMAAKLGKIGVFQHIIRREIKDE
EVRHLSRKFKDWAYGPVYSSLYDLSSLETCGEEPSVLEILVYNSRNENCHEMLAVEPINE
LLRAKWQKFAAVTFYISVVSYLITMIIFTLVAYYHPTEGKPPFPYTTSTDYLRMVGEIFT
LASGIFFFLTNIKDLFLKKRPGVKSLVMDGSFQLLYFIYSILIIITAALYLSGIKAYVSV
MVFALVLGWMNTLYFTRGLKLTGTYSIMIQKILLKDIFRFLLVYLLFMIGYASALVSLLT
VCPTSGPECEGGCPTYPKCREPGTFSTFLLDLFKLTIGMGDLEMINSAQYPEVFLILLVT
YIILTFVLLLNMLIALMGETVGQVSKESKKIWKLQWATTILDIEHSFPVCLRRSFRVGEM
VTVGKNLDGTPDRRWCFRVDEVNWCHWNQNLAIINEDPGRSDTSQTNGLRQSVKGLRRDR
WTTVVPRVMELSKSPQPHDLVVEMEPLTTRN
NT seq 2616 nt   +upstreamnt  +downstreamnt
atgaatgagggccgttctgctctcctcagaaggtgccatcttgccttttcacgagcagac
actcttggctctgctggatctgctgcatcagaggactgtaaagagggagatgctgctcag
gcagagggagaagctgccttcccgctctcagagctctcacagctgtttgaaagtgaggat
ggctcccagtccgctcaggacactagccaggaatccgccttggagctggtccagcctggc
aaccctgcagacagcagacagaacctgaggacaaagtttcagggtgctttcaggaagggc
atctcccacccaatggacctgtttgaggccaccatatatgaatcaaatgttgttccagcc
cctaaaaaagctccaatggactcactatttgactatggcacctatggaaattctagtaac
cagaagaaacgtcgcaaaaagctcccaagaggcaaaactgaagcatcctgtgacatcgtt
ccaaaccctgacccacctaaagtaatgaaaatattcaaccgcattctgctatttgactgt
gtgtcacgtggagacccagaggacctcgagggcctgttggagtacctgcaagttcacgag
aagaggttaaccgatgaggagtttagagaaccatccaccggtaagacctgcctgcctaaa
gccctgctgaacctttatggaggtcggaacaacaccatcccactgctggtggacattgca
gagaagactggaaatctcagagagttcattaacacacccttcagggatgtctactacaga
ggtcagacggcgctccacatcgccatcgagcggcgctgtaagcattatgtggaactgctg
atggagaagggggcagatgtccacgcccaggcaagggggcgcttcttcgagccaaaagac
gaggggggttacttttactttggtgagctgcccctttcactggctgcgtgcactaatcag
cccaacatagtgaattacctgacagagaatccacacaagaaggccgacctgcggcgccag
gattcacgtggaaatacagcgctgcacgcattagtgcacattgcagacaacaccaaggac
aacactcgttttcttacaaagatgtacgacctgctgctaattaagtgtaccaagctctac
cctgagtgcaacctggagaaaatggccaacaacgatggcctgacccctcttatgatggct
gccaaacttggcaagataggggttttccaacacatcataaggcgtgagatcaaagatgag
gaagttcgtcatctttcacgtaagtttaaggactgggcttacggtccagtgtactcctcc
ctctatgacctgtcttcattggaaacatgtggggaggaaccgtctgtcctggaaatcctc
gtctacaacagtcgcaatgagaactgccatgagatgctggcagtggagccaatcaatgag
ctgctgagagccaaatggcagaagtttgcagctgtcactttttacatcagtgtggtatcc
tacctcatcaccatgatcatcttcaccttagtggcttattaccatccaactgagggaaag
cctcctttcccgtacactacatctactgactacttgagaatggttggagagattttcacg
ctggcatcgggaattttcttcttcctcacaaatattaaggacctcttcctgaaaaaacgc
ccaggggtgaaatcattagttatggatggatcctttcaacttctgtacttcatctactct
atcctgataatcatcacagctgctctgtacctgtctggcattaaggcatatgtctctgtg
atggtgtttgctctggtgctgggctggatgaacactctttacttcaccagaggcctgaag
ctcactggcacctacagcatcatgatccaaaagattctcctcaaagacatcttcaggttt
ctgttggtatatttactcttcatgattggatatgcttccgccctggtgtccctgctgaca
gtgtgccccacatccgggccggagtgtgaaggaggctgccccacctaccccaaatgcaga
gagccaggcacattcagcactttcctcttagatctattcaagctgaccattgggatggga
gacctggaaatgatcaacagtgcacagtatccagaagtcttcctcatcctcctagtcact
tacatcattctcacctttgtgttgctgctgaacatgttgatcgctttgatgggggagact
gtgggacaggtgtccaaggaaagcaaaaagatctggaaacttcagtgggcaacaaccatc
ctggacatcgagcactcattcccagtctgtctacgaaggtctttccgagttggtgagatg
gtgacggttgggaagaatttggatggcacaccggatcgacgctggtgtttcagagtggat
gaagtaaactggtgtcactggaatcagaatcttgcaataatcaatgaggacccaggcaga
agtgacaccagtcaaaccaacgggctgcggcagagtgtcaaaggcttaaggagagatcgc
tggaccaccgtggtcccgcgggtgatggagttaagtaagagtcctcaaccccatgacctg
gtggtggagatggagccgttgacgacacgaaattga

DBGET integrated database retrieval system