KEGG   Oryzias latipes (Japanese medaka): 101170218
Entry
101170218         CDS       T02443                                 

Gene name
cop1
Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
ola04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101170218 (cop1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101170218 (cop1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ola04121]
    101170218 (cop1)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101170218 (cop1)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101170218 (cop1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     101170218 (cop1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-RING_10 zf-rbx1 zf_C2H2_10 Prok-RING_4 DZR UvrD-helicase zf-RING_4 FemAB
Other DBs
NCBI-GeneID: 101170218
NCBI-ProteinID: XP_011484888
UniProt: H2MCQ3
LinkDB
Position
17
AA seq 705 aa
MSSSRTQQQGGGGGASSVPSTSNSSSGNASNAVTSNGNNSGNVVPSRTLPAAGEGGSSVP
SLATVPSSRGGFASLNRPSASSGNRRKSLHQAPLYNGLLNSYEDKSNDFVCPICFEMIEE
AHMTKCGHSFCYKCIRQSLEDSNRCPKCNYIVDNVDQLFPNFLVNELILKHKQRSEEKRL
KLDHPNGSRWQVFQDVLSPDQENLDLANVNLMLELLVQKKKQLEAESQAAQRQILMEFLK
EARKNKKEQLDQLQKELNFLEEDIKRVEEMSGLHSPVMEAECTVPNVETPSPGPSCSSII
EPADYTQPPGFGGSTQGKRQTWYNSTLASRRKRLTAHFDDLEQCYFSSKMSRITDEGRTL
NQLDDFMECLSKFTRYNTVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIAGVTKKIK
VFEYGTVIQDAVDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVILWDGFTGQRS
KVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVCCVKFSPT
SRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTDSQLKLWN
VNKPHCLRSFKGHINEKNFVGLASNGDYVACGSENNSLYLYYKGLSKTLLTFKFDTVKSV
LDKDKKEDDTNEFVSAVCWRALPDGESNVLIAANSQGTIKVLELV
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgtcaagcagtcggacgcaacaacaaggcggcggtggtggcgcgagttcagtacccagc
accagcaatagcagcagcggcaatgcgagcaacgccgtaacaagcaatgggaacaattct
ggaaatgttgtgccctcccggactctgcccgcagccggagaggggggctcgtctgtgccc
tctctggccactgtaccgtcgtcccggggcggctttgcttccctcaacagaccctctgcg
tcctcaggcaacagaaggaaatcccttcaccaggcacccttatacaacggcctcttgaat
tcttatgaagataaaagcaacgattttgtctgtcccatttgcttcgaaatgatagaggag
gcgcacatgaccaagtgtggacacagtttctgttacaagtgtatccgccagagcttggaa
gacagcaacagatgtcccaagtgtaactatattgttgataatgtggatcagctgttccca
aactttttagtaaacgagctgatccttaaacacaagcaaagatcagaggagaagaggcta
aaattagaccatcctaacggttctcggtggcaggtcttccaggatgttttgagtcctgat
caggaaaacctggatctggcaaatgtcaatctgatgttggagcttttggttcagaagaaa
aagcagctggaagctgaatcacaagcagcccaacgacagatcctcatggagttccttaaa
gaagctcggaaaaataaaaaagagcaattagaccaacttcagaaagagctcaacttcctt
gaagaggacattaagcgtgtcgaggaaatgagcggacttcactccccagtgatggaagca
gagtgtacggtgccaaacgtcgagacgccctctccaggtccaagttgtagtagcatcatt
gagcctgcagattacacgcagcctccaggatttggtggaagcacccagggaaaacgacag
acgtggtacaacagcacgttagcgtcgaggaggaagagactgacggctcattttgatgat
cttgagcaatgctacttctcaagcaaaatgtcacgcatcacagatgagggtaggacctta
aaccaactggatgacttcatggagtgtttgtccaaattcacacgctacaacactgtgcgg
ccactggccacactgtcctatgccagcgacctctataatggctccagcattgtctccagt
atcgagtttgaccgtgactgtgactactttgccattgctggtgtgaccaagaagatcaag
gtgtttgagtacggcaccgtgatccaggatgccgtggacatccactatcctgtgaacgaa
atgacctgcaattccaaaatcagctgcatcagctggagtagttatcataagaaccttctg
gctagcagcgattatgagggaaccgtcattctgtgggatggattcaccggccagcggtcc
aaagtctaccaggaacatgaaaaaaggtgttggagtgtcgactttaatctgatggacccc
aaacttttagcttccggctctgatgatgctaaagtaaagctgtggtcaaccaatctggac
aactcagtagcgagcatcgaggctaaagctaacgtatgctgcgttaaatttagcccaaca
tccaggtatcatctggcattcggctgtgcagaccactgtgtccactactacgatctccgc
aacactaagcagccaatcatggttttcaaaggccacaggaaggccgtgtcctacgctaag
tttgtaaatggggaagaaatcgtttctgcttcgacggacagccagctgaagctttggaac
gtcaacaaacctcactgcctgcgctcctttaagggtcacatcaacgagaagaactttgtt
ggactggcgtcaaatggagactatgttgcctgtggaagtgagaacaactccctgtacctg
tattacaaaggactttccaaaacactgttaacattcaagttcgacacggtgaagagtgtt
ttggacaaagacaagaaagaagatgacaccaatgagtttgtgagtgccgtctgctggaga
gccctgcctgatggagagtcaaatgttctcattgctgcgaacagtcaaggaactatcaag
gttcttgaacttgtctga

DBGET integrated database retrieval system