KEGG   Oryzias latipes (Japanese medaka): 101170451
Entry
101170451         CDS       T02443                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101170451 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ola03000]
    101170451 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ola03310]
    101170451 (nr3c1)
Transcription factors [BR:ola03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    101170451 (nr3c1)
Nuclear receptors [BR:ola03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   101170451 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 101170451
NCBI-ProteinID: NP_001292330
UniProt: H2L7X2
LinkDB
Position
14
AA seq 793 aa
MDQGELKLNGNQGGSLSYGEIRPEACRDTGDSSDLLFQSAMHLPGSSSVAPNGQGGTKGQ
GEVGGFFEPPEHTIPCEGSEAQGDKLIRMQKSEQNVFSMGENLTLVSESISDPKQAPTCV
ISASDRSVLGNLPLPDLFSQHIKQEGMFYMDKDFGAYSGQCDLDSNSTPLIDDAEIWRDL
DLTSSLDEINALELDSEVAQLDTFLQDSKCASVDSPSGLLKETKSLMGNGANFTSVNGTE
QQQHPQVHQQPPLHLAQHQQPQTHHQQLQPILSSVVIKEEKDPDFIHIRTPGVVKQEKQD
SYCQSQCLQSGMSSLHGGEGGGSLSSPVCMGAGSGYPYRASPPSTVTLQDQKPFGIYPNL
LGERWIEGKGYGESPGKPSSSDGLASASGLPGFPASFSNSSSRTAESGGGVSSGHSKPSG
QTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIID
KIRRKNCPACRFRKCLQAGMNLEARKNKKLIKMKRPSGSSEPVNNNNNLPVPIIPRSMPQ
LVPTMLSVLKAIEPEVIFSGYDSTLPDTSSRLMSTLNRLGGQQVISAVKWAKSLPGFRNL
HIDDQMTLLQCSWLFLMSFSLGWRSYEQCNGSMLCFAPDLVINTDRMQLPFMTDQCDQML
KICKEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMVYIKELGKAIVKREEN
ASQNWQRFYQLTKLLDSMQEMVEGLLQICFYTFVNKTLSVEFPDMLAEIITSQIPKFKDG
GVKALLFHQKGLP
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggatcaaggggaactgaagctcaatggtaatcaaggcggcagcctttcatatggcgag
ataagacccgaagcatgcagagatactggtgactcatctgatttactcttccagtccgcg
atgcatctgcccggttccagttctgtggccccaaatggacaaggtggaactaaaggccag
ggggaggttgggggcttttttgaacctcctgagcatactattccatgtgagggctctgaa
gcacagggagataaattgatcagaatgcagaaatcagaacagaatgtattcagcatgggg
gaaaacctgacgctggtgagcgagagtatctccgatcccaagcaggcacccacctgtgtc
atcagcgcttcggacaggtctgtactgggcaacctccctctgcctgaccttttttcacag
cacatcaagcaggaggggatgttttatatggataaagactttggagcttacagtggacag
tgtgatttggatagcaacagtactcccctgatcgatgatgcagagatctggcgagacctg
gaccttacaagctcgctggacgaaatcaatgccttggagttggattcagaggtggcacaa
ttggataccttcctgcaagacagcaagtgtgctagcgttgattctcctagtggcttgctg
aaggaaacaaagtctctcatgggcaatggagcaaactttaccagtgtaaacggcacagag
cagcagcaacaccctcaagtacaccagcagcctcctctccacctggcacagcaccagcag
cctcaaactcaccatcagcagcttcaaccaattctctcaagtgtcgtcatcaaggaggag
aaggatcctgacttcatccacattcggacccctggggtggtcaagcaggagaagcaggac
agttactgccagtcacagtgtctccagagtggcatgagctccctccacggaggtgaaggg
ggaggctccttgtcctcacctgtatgcatgggtgctggatctggttacccctacagagcc
agtccaccctccacggtcaccctgcaggatcagaagccttttggcatatacccaaaccta
ctgggagagaggtggattgagggaaaaggctacggagagtcacctggaaaacccagcagc
agtgatggactggcctctgcctcaggcttgccaggtttccctgccagcttttccaattca
tcatccagaacagcagagtccgggggtggggtgtcgtctggtcactccaagccaagtggg
cagactcacaagatctgtttggtgtgctctgacgaggcttcaggatgccactatggggtt
gtaacctgcggcagctgcaaggtgttcttcaagagggcagttgaaggatggagagcacga
caaaacacagatggtcagcacaactacttgtgtgcagggagaaatgattgcatcattgat
aagatccgcaggaagaactgccccgcgtgccgcttcaggaaatgtcttcaagctggaatg
aacttggaagcgaggaaaaacaagaagctgatcaagatgaagcggccttcaggctcatcc
gagcccgtcaacaacaacaacaacctgcctgtcccgatcatacccaggagcatgcctcag
ctcgtgcccaccatgctgtctgtgctcaaggccatcgaaccagaggtcatcttctcgggc
tacgatagcacgctgccggacacctcctcccgactcatgagcactctgaacaggcttgga
gggcagcaggtcatctctgcagtcaagtgggccaagtcactgccaggctttcgtaacctg
cacattgatgaccagatgacgctgctgcagtgctcctggctcttcctcatgtccttcagt
cttggttggagatcctatgagcagtgtaacggcagcatgctctgcttcgcccccgatctc
gtcatcaacacagatcgcatgcagctgcccttcatgaccgaccagtgcgaccagatgctg
aaaatctgcaaggagtttgtcagactgcaggtgtcctacgatgagtacctgtgcatgaag
gttcttctcctgctgagtacagtgccgaaggacggcctgaagagccaggcggtcttcgac
gagatccggatggtctacatcaaggagctgggaaaagccattgttaagagggaggagaac
gccagtcagaactggcaacgcttctaccagctaactaagctactggattccatgcaggag
atggttgagggtcttctgcagatctgcttctacaccttcgtgaataaaaccctcagtgtg
gaattcccagacatgctggcggagatcatcaccagccagataccaaaattcaaggacggc
ggcgtgaaagctctgctgtttcaccagaagggactgccttaa

DBGET integrated database retrieval system