KEGG   Oryzias latipes (Japanese medaka): 101170780
Entry
101170780         CDS       T02443                                 

Gene name
chek1
Definition
(RefSeq) serine/threonine-protein kinase Chk1 isoform X1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101170780 (chek1)
   04115 p53 signaling pathway
    101170780 (chek1)
   04218 Cellular senescence
    101170780 (chek1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101170780 (chek1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ola03400]
    101170780 (chek1)
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101170780 (chek1)
Protein kinases [BR:ola01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   101170780 (chek1)
DNA repair and recombination proteins [BR:ola03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    101170780 (chek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH FTA2
Other DBs
NCBI-GeneID: 101170780
NCBI-ProteinID: XP_004076424
UniProt: H2LMC8
LinkDB
Position
14
AA seq 454 aa
MAVPFVQDWDVVQTLGEGAYGEVRLLVNRQTEEAVAVKVIDTSQAEECAENVKKEICIHK
ILNHCNIVRFFGHRREGTTVYLFLEYCTGGELFDRIEPDVGMPERDAHRFFQQLIAAVEY
LHKLGITHRDIKPENILLDDKDNLKLTDFGLATMFRFKGRERRLNRLCGTLPYVAPELLS
QSEYHAQPADIWACGIVLTAMLAGELPWDQPTESCQEYADWLQRKTYLPPWKKIQPAPLS
LLSKLLQPNPNTRITGEELKKDRWFTQGCLSSGCSKVLHNNRDFMFRASSDDRMQLSSSQ
PDFAAGGWEAMLVFGQSEGQVSFSQPTKPEHMLLGSQLLATPGASQSPWQKLVRRMTRFF
TTVDADATLSALKDTCDALALGFKLTCRQVTLNTLDKRNNPLVFKVLLLHLNQKVLLDFR
LSKGDGLEFKRLFVKIKQKLGDIVNSQKILLPVV
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggcggtgcctttcgtgcaggactgggacgtggtccagacgctgggagaaggagcttat
ggagaagtgaggctgctggtgaacaggcagacggaggaggcggtggcggtaaaggtgatc
gacacgtcacaagcagaggagtgtgcagaaaatgtcaagaaagagatctgcatccataag
attctcaaccactgcaacattgtaaggtttttcggtcatcggagagaaggaacaaccgtc
tatctcttcctagaatactgcactggaggggagctgtttgaccgcattgaacctgatgtg
gggatgccagagagagatgctcatcggtttttccagcagctcatcgccgctgtggaatac
ctccacaaactcggcatcacccacagagacataaaacctgagaacattcttctggatgac
aaagacaatctgaagctgaccgactttggcctggctaccatgtttcgcttcaaaggacgc
gagcggcgtctgaatcgactctgtggaactctgccttatgtggctccggaactgctcagc
caaagcgagtaccacgctcagcccgcagacatctgggcgtgtgggatcgtcctcactgcc
atgctggctggagagctgccatgggaccaacccactgagagctgtcaggagtatgcagac
tggcttcagaggaaaacctacctacctccctggaagaaaatacaaccagccccccttagc
ttgttgtccaaattactgcaacccaatcccaatacccggatcactggagaagagctaaag
aaagaccgctggtttacacaaggatgtctgagctcgggctgcagcaaggttcttcacaac
aacagggattttatgttccgtgctagcagtgacgacaggatgcagctgtccagctctcag
cctgattttgccgctggcggctgggaagccatgctggtgtttgggcaaagcgaaggtcaa
gtcagcttctcgcagccgaccaagcctgagcacatgctgctgggtagtcagttactggcc
acgcctggagccagtcagtcgccgtggcagaaattagttcggagaatgacccgtttcttc
accacagtggatgctgatgcaactttgtctgcgctgaaagacacctgtgatgctcttgca
ctcggtttcaaactcacctgcagacaggtaactctgaacacgctggataaacgcaacaac
ccgctagtctttaaggtcctgctcctgcatttgaaccagaaagtgcttctggacttcagg
ctgtctaagggtgacggtttggagttcaagcgcctctttgtgaaaatcaagcagaagctg
ggcgacattgtcaacagtcagaagattttactgcctgtggtgtga

DBGET integrated database retrieval system