KEGG   Oryzias latipes (Japanese medaka): 101171354Help
Entry
101171354         CDS       T02443                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00480  Glutathione metabolism
ola00980  Metabolism of xenobiotics by cytochrome P450
ola00982  Drug metabolism - cytochrome P450
ola00983  Drug metabolism - other enzymes
ola01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101171354
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101171354
   00982 Drug metabolism - cytochrome P450
    101171354
   00983 Drug metabolism - other enzymes
    101171354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ola02000]
    101171354
Enzymes [BR:ola01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101171354
Transporters [BR:ola02000]
 Other Transporters
  Pores ion channels [TC:1]
   101171354
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101171354
NCBI-ProteinID: XP_004077139
UniProt: A0A3B3ICK8
LinkDB All DBs
Position
15
AA seq 239 aa AA seqDB search
MSTEKSFAKGSAAPGPVPKDHIRLYSMRFCPFAQRTRLVLHTKGIKFETINIHLKEKPEW
FFQKNPLGLVPVLETPAGEIICESSITSEYLDEAYPEKKLLPSSAYAKAQQRMMLEHFSK
IIPFFYRIPSAKRNGEDVSGMEAELKEKLGKLNEELVQKKTKFFGGDSITMIDYMMWPHF
ERTEVYGVQNCLEHTPELKKWMGRMLEDPAVKATMFSKEAHEAFYKSFIDGKPDYDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgaaaagtctttcgcaaaaggaagtgctgctcctggcccggtccctaaagac
cacatcagactttacagcatgaggttttgcccttttgctcagaggaccagattagtgctg
cacaccaaagggataaagtttgaaaccatcaacatccacctgaaggaaaaacctgaatgg
ttcttccagaagaaccccttaggtcttgtcccggtgctggagacccctgcaggggaaatt
atctgtgagtcgtccatcacctctgagtacctggatgaagcctatccagagaagaagctg
cttccatcctctgcttatgccaaagctcagcaaagaatgatgttggagcatttttcaaag
atcataccattcttctacaggattccatccgcaaagaggaatggcgaagatgtgtcagga
atggaggctgaactgaaagaaaaattggggaaacttaatgaagagttggtgcaaaagaaa
acaaagttctttggaggcgattccatcacaatgattgattatatgatgtggccacatttt
gagagaactgaggtctacggggtgcagaactgcctggagcacacacctgagctgaagaag
tggatggggcgaatgttggaggatccagctgtgaaggcaacaatgttcagcaaagaagca
cacgaggccttctacaagagcttcatagacgggaaaccagattatgactacggcctttaa

DBGET integrated database retrieval system