KEGG   Oryzias latipes (Japanese medaka): 101171402
Entry
101171402         CDS       T02443                                 

Gene name
gorab
Definition
(RefSeq) RAB6-interacting golgin
  KO
K19748  RAB6-interacting golgin
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101171402 (gorab)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101171402 (gorab)
Membrane trafficking [BR:ola04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    101171402 (gorab)
SSDB
Motif
Pfam: Transcrip_act DUF1127
Other DBs
NCBI-GeneID: 101171402
NCBI-ProteinID: XP_023810183
LinkDB
Position
4
AA seq 342 aa
MSSWAGFSDEELRRMQQKDSAKAAAAGPARKTPSSSRSRQQLQRERLLQLSVQKSTQAGT
AALPAEQKLQQPPPKEEVQPAAGSGPSAAAAPAVRPDGPNKAAAIQPHDENHHVTAEEET
PAVKELEQQEAEVREKTRLEQLQQDQKLIEEKNKRKKALLAKTIAEKSKQTQAEAVKLKR
IQKELQALDDMVSNDIGILRGKIEQASWDYSSARKRFEKAEAEYVSAKLDLHRKTEVKEQ
LTEHLCAIIQQNELRKAHKLEELMQQLQLQATEEEVEEEEEEGRRNGEEALGKAKEGSDS
SEKQKPKEQESKDSKEQTEKEAASEQEFRPQENCVPAEAVDS
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgagcagctgggcgggattctccgatgaggagctgcggaggatgcagcagaaagactcg
gccaaagccgcagcagccggccccgctcggaagacgccttcctccagccggagtcgacag
cagctgcaacgtgagaggctcctgcaactgtccgttcagaagagcactcaggctggaacc
gctgcccttccggcggagcagaagctccaacagccgcctccaaaagaggaggttcagccc
gccgccgggtcaggaccttctgctgctgctgctcctgccgtcagaccggacggtccgaat
aaagccgctgcaatccaacctcatgatgagaaccatcacgtgactgcagaggaggagacc
ccagcagtcaaagagctggagcaacaggaggcagaagtacgagaaaagacgcgcctggag
caactgcagcaggatcaaaagctcatcgaagagaagaacaaacgtaaaaaagctctgctg
gcaaaaactattgctgagaaatccaaacagactcaagctgaggccgtgaagctaaagagg
attcagaaggagctgcaggcgctcgacgacatggtgtccaatgacatcggcatcctcagg
gggaagatcgagcaagccagctgggactacagctctgccaggaagcgtttcgaaaaggcc
gaggccgagtacgtttcagccaaactggacctgcacaggaagacagaggtgaaggagcag
ctgacggagcacctgtgtgccatcatccagcagaacgagctgcgcaaagcccacaagctg
gaggagctgatgcagcagctgcagctgcaggccaccgaggaggaggtggaggaggaggaa
gaggaggggaggaggaatggagaggaagcactgggaaaagccaaagagggaagcgactcc
tctgagaagcagaagccgaaggaacaggaatcaaaagactcaaaggagcagactgagaag
gaggcggcatccgagcaggagttcagaccacaggagaactgtgttcccgctgaagctgtg
gactcctga

DBGET integrated database retrieval system