KEGG   Oryzias latipes (Japanese medaka): 101171672Help
Entry
101171672         CDS       T02443                                 

Gene name
acaa2
Definition
(RefSeq) 3-ketoacyl-CoA thiolase, mitochondrial
  KO
K07508  acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00062  Fatty acid elongation
ola00071  Fatty acid degradation
ola00280  Valine, leucine and isoleucine degradation
ola01100  Metabolic pathways
ola01212  Fatty acid metabolism
Module
ola_M00085  Fatty acid elongation in mitochondria
ola_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    101171672 (acaa2)
   00071 Fatty acid degradation
    101171672 (acaa2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101171672 (acaa2)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     101171672 (acaa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 101171672
NCBI-ProteinID: XP_004072217
UniProt: H2LBC5 A0A3P9K8S4
LinkDB All DBs
Position
9
AA seq 396 aa AA seqDB search
MALLRGVFVVSAKRTPFGTYGGVLKDHSATDLAEHAAKAALAAGGVAPELINSVILGNVM
QSSADAPYIARHVGLRCGVPIPVPALTVNRLCGSGFQSIINGTHEICLRESEVVLCGGSE
SMSQAPYAVRNIRFGTKFGLDLKLEDTLWAGLTDLHVKIPMGITAENLAEKYEITREDCD
KFAYQTQQRWKAAHEGGHFTAEIAPVDIKTKKGKVPMAQDEHPRPQTTPEQMAKLPSVFK
KGGTVTAGNASGVSDGAAALVIASDDALKEHKLTPLARIVAYHVSGCDPSIMGIGPVPAI
TGALKKSGLSLNDMDLVEVNEAFAPQFLAVSKALGLDPEKTNVNGGAIAIGHPLGASGAR
ITGHLVHELRRRGGKYAVGSACIGGGQGIAIILERC
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcacttctcagaggtgtgtttgttgtgtcagccaagcgcactccctttggaacctat
ggtggagtgctgaaagaccacagtgcaacagacttggcggagcatgcagccaaagccgcc
ctcgctgcagggggtgtggccccagagcttatcaacagcgtcattttgggaaatgtcatg
cagagctcggcggatgccccatacattgctcgccatgtcggcctgaggtgtggcgttccc
atccccgtgcctgctctcactgtgaacagactgtgtgggtctggcttccagtctatcatc
aatggtactcatgagatctgcctcagagagtcagaggtggttttgtgtggaggttcagag
agcatgagccaggctccctatgctgttcgcaacattcgctttggaacaaagtttggactt
gatcttaagctggaggacaccttgtgggcgggtctgactgacctgcatgtaaagatacca
atgggaatcacagcagagaatctggcagaaaaatacgagatcacacgagaggactgcgac
aaatttgcttaccagacgcagcaaaggtggaaggcagctcacgaagggggtcacttcaca
gctgaaattgcccccgttgacataaaaacaaaaaaaggaaaggttcccatggctcaggat
gaacacccgcggcctcaaaccacaccagaacaaatggccaaactgccgtcagtcttcaaa
aaggggggaaccgtcactgctggaaatgcatcgggggtgtctgatggtgctgctgctctg
gtgattgcaagtgatgatgctctgaaagaacacaagctcacgccgctcgccagaattgtg
gcttatcatgtgtcaggctgtgacccgagcattatgggtatcggtccagtcccagcgatt
acaggagctcttaagaaatctggtctgtctctaaatgacatggatctggtggaggtgaat
gaagcgtttgctccccagtttctggctgtttcaaaggctcttgggctggacccagagaaa
accaatgtaaatggcggagctattgcgatcgggcatcctctcggtgcctctggagctcgc
atcactggccaccttgtgcacgaactcaggcgtagaggtggaaaatacgccgttggatct
gcctgtatcggtggaggtcagggcatcgccatcatcctcgagaggtgttga

DBGET integrated database retrieval system