KEGG   Oryzias latipes (Japanese medaka): 101171856Help
Entry
101171856         CDS       T02443                                 

Gene name
pten
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X2
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00562  Inositol phosphate metabolism
ola01100  Metabolic pathways
ola04068  FoxO signaling pathway
ola04070  Phosphatidylinositol signaling system
ola04115  p53 signaling pathway
ola04140  Autophagy - animal
ola04150  mTOR signaling pathway
ola04218  Cellular senescence
ola04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101171856 (pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101171856 (pten)
   04070 Phosphatidylinositol signaling system
    101171856 (pten)
   04150 mTOR signaling pathway
    101171856 (pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101171856 (pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101171856 (pten)
   04218 Cellular senescence
    101171856 (pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101171856 (pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101171856 (pten)
Enzymes [BR:ola01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101171856 (pten)
    3.1.3.48  protein-tyrosine-phosphatase
     101171856 (pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101171856 (pten)
Protein phosphatases and associated proteins [BR:ola01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101171856 (pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 101171856
NCBI-ProteinID: XP_004077141
UniProt: A0A3B3IPA9
LinkDB All DBs
Position
15
AA seq 416 aa AA seqDB search
MAAIIKEMVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDAAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLEAQEALDFYGEVRTRDKKGVTIPSQRRYVCYYSY
LLKNQLEYKPVALLFHKMVFETLPMFSGGTCNPQFVVYQLKVKIHTSNPLHTRREDKHMY
FEFPQPLPVCGDIKVEFFHKQNKMMKKDKMFHFWVNTFFIPGPEESGDRMENGSVNDAES
QPSGPGQGQPQNAECRDGCREGDRDRDYLILTLNKNDLDKANKDKANRYFSPNFKVKLYF
TKTVEEPSNSEASTSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEEQHTQITKV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgattataaaagaaatggtcagtcggaacaaaaggagataccaagaggatggt
ttcgacctggacttaacatatatctaccccaacattattgctatgggctttccagcagaa
agacttgaaggcgtgtacagaaacaatatagacgatgtagttcggtttttggattcaaag
cataaaaaccattacaaaatctacaacctctgcgcagaaagacactacgatgctgccaaa
tttaactgcagagttgcacagtacccctttgaagaccacaaccctcctcagctggagcta
attaagccgttctgtgaagacctggaccagtggctcagcgaggacgacaatcacgtcgca
gccatccactgtaaggctgggaagggccgcaccggagtcatgatctgcgcttatcttctt
catcggggcaaattcttggaggcccaggaagccctggacttttacggtgaagtccggaca
agggacaagaagggagttacgatcccaagccagcgccgctacgtctgctactacagctac
ctactgaagaaccagcttgagtacaagccagtggcgctgctcttccacaaaatggtcttt
gagactctccctatgttcagcgggggcacctgcaatccccagtttgtggtctatcagctg
aaagtgaagatccacacgtcaaaccccctccacacacggcgggaggacaagcacatgtat
ttcgagttcccgcagccgctcccggtttgcggagacatcaaagtggagttcttccacaaa
cagaataagatgatgaaaaaggacaaaatgtttcacttctgggtgaacaccttcttcatc
cctggaccagaggagagcggggacaggatggagaacgggtctgtgaacgatgcagaaagc
caaccgagcgggccgggtcagggccaaccacagaacgcagagtgcagggacggctgcagg
gaaggcgaccgggacagggactacctcatcctgacgctcaataagaacgacctggacaag
gcgaataaggataaagccaaccgctacttctcgccaaacttcaaggtgaagttgtatttt
acgaaaaccgtggaggagccctcaaactctgaggcaagcacttcgacttccgtcaccccg
gacgttagcgacaatgagccagaccattatcgatactctgacaccactgactctgatccg
gaaaatgaaccttttgatgaagagcagcacacgcaaatcacaaaagtgtga

DBGET integrated database retrieval system