KEGG   Oryzias latipes (Japanese medaka): 101171945Help
Entry
101171945         CDS       T02443                                 

Gene name
bad
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04012  ErbB signaling pathway
ola04140  Autophagy - animal
ola04210  Apoptosis
ola04370  VEGF signaling pathway
ola04510  Focal adhesion
ola04910  Insulin signaling pathway
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101171945 (bad)
   04370 VEGF signaling pathway
    101171945 (bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101171945 (bad)
  09143 Cell growth and death
   04210 Apoptosis
    101171945 (bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101171945 (bad)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101171945 (bad)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101171945 (bad)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bcl-2_BAD Bclx_interact
Motif
Other DBs
NCBI-GeneID: 101171945
NCBI-ProteinID: XP_011485704
UniProt: A0A3B3HDU2
LinkDB All DBs
Position
18
AA seq 164 aa AA seqDB search
MAAKFTISDDSESSEEVEGGKLDLGAAAGGEGEHLHDRHSLTLPELRLTSNGRTRLNSES
TASTYSRDEDLAREDEAGTPTDGLAFRGRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDK
GEMRKVRSTGAAKQMLHSTSWWNYLFSHPEAEGEYSHHESHRTE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagttcaccatctcagacgattcggagtcatccgaggaggtagagggagga
aaacttgacctgggagcggcagcaggaggagaaggggagcaccttcatgatcgacattcc
ctcaccctgccagagcttcgactcacaagtaacgggcgtaccaggctgaattcagagtcc
accgcttccacgtactccagagatgaggacctcgcgcgggaagacgaggccggaaccccc
actgatgggttggccttcaggggcagatccaagtcggcccctccggctctgtgggccgcc
aaaaagtacggtcagcagctccgacggatgagcgacgagtttgacagcctgctggataaa
ggggagatgaggaaggtgaggagcactggggcggccaaacagatgctccactccacgagc
tggtggaactacctcttcagccacccggaggcggaaggagagtacagccaccacgagagc
caccgcactgagtaa

DBGET integrated database retrieval system