KEGG   Oryzias latipes (Japanese medaka): 101172038
Entry
101172038         CDS       T02443                                 

Gene name
siva1
Definition
(RefSeq) apoptosis regulatory protein Siva
  KO
K22744  apoptosis regulatory protein Siva
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101172038 (siva1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 101172038
NCBI-ProteinID: XP_004082403
LinkDB
Position
22
AA seq 170 aa
MPKRTCPFPEVFSSQYKIHVRQQELNNYGVFGSKYRQEIYEKTKNLLFNGAKAVISTIWT
GEEKSAAPQPSAQTDSPACSKTLLRGQMLIGHDGRLTRAGAAKGNPVGPTGCCVCQKSQG
PRTPCSQCDRLACSSCVRQCSNCCSLCCSVCTILDYSGRYDEVLCCGCST
NT seq 513 nt   +upstreamnt  +downstreamnt
atgcctaaacgaacttgtcctttccccgaagtcttttcttctcaatataagatacatgtc
agacagcaggaactgaacaactatggagtgtttggcagcaagtatagacaagagatatac
gaaaaaacgaagaacttgcttttcaacggtgccaaagctgtgatcagtacaatatggacc
ggggaagagaagagtgcagctccgcagccctctgcacaaacggattcacctgcatgcagc
aaaacccttctgagaggacagatgctgattggccacgacgggagactaacgagggcgggt
gctgctaaaggtaacccagtgggtcccacaggttgctgtgtgtgtcagaagagccaggga
cccaggacgccgtgttctcagtgtgatcgactggcgtgttcatcctgtgtccgacagtgc
tccaactgctgcagcttatgctgctctgtctgcaccatcttagattacagcgggcggtac
gatgaagtactctgctgcggctgctctacgtaa

DBGET integrated database retrieval system