KEGG   Oryzias latipes (Japanese medaka): 101172271Help
Entry
101172271         CDS       T02443                                 

Gene name
aldh2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00010  Glycolysis / Gluconeogenesis
ola00053  Ascorbate and aldarate metabolism
ola00071  Fatty acid degradation
ola00280  Valine, leucine and isoleucine degradation
ola00310  Lysine degradation
ola00330  Arginine and proline metabolism
ola00340  Histidine metabolism
ola00380  Tryptophan metabolism
ola00410  beta-Alanine metabolism
ola00561  Glycerolipid metabolism
ola00620  Pyruvate metabolism
ola01100  Metabolic pathways
Module
ola_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101172271 (aldh2)
   00053 Ascorbate and aldarate metabolism
    101172271 (aldh2)
   00620 Pyruvate metabolism
    101172271 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101172271 (aldh2)
   00561 Glycerolipid metabolism
    101172271 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101172271 (aldh2)
   00310 Lysine degradation
    101172271 (aldh2)
   00330 Arginine and proline metabolism
    101172271 (aldh2)
   00340 Histidine metabolism
    101172271 (aldh2)
   00380 Tryptophan metabolism
    101172271 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101172271 (aldh2)
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101172271 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101172271
NCBI-ProteinID: XP_023819655
LinkDB All DBs
Position
16
AA seq 520 aa AA seqDB search
MLGLRSAVFRAVTPLSRVLACRFSAAPIPVPNTQPEVHYNKLFINNRWQDAESGKTFPTI
NPATGEVICQVAEADESDVNKAVKAASDAFRLGSPWRRMDASHRGLLLNRLADAIERDAA
YLAELETLDNGKPYAVAYSVDLPNVVKCLRYYAGWADKWEGKTIPIDGDYFCYTRHEPVG
VCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTPLTALYVASLIKEVGFPEGVVNI
LPGMGPTAGAAIARHMDVDKVAFTGSTEVGHLIQQASGSSNLKRVTLELGGKSPNIVLSD
ANMEDAVEQSHFALFFNQGQCCCAGSRTYVQADIYDEFVERSVERAKRRVVGDPFDMKTE
QGPQVDQEQFNKILGYISSGKREGAKLMCGGGVAADRGYFIQPTVFGDVQDNMTIAREEI
FGPVMQIFKFKTLEEVLTRANDSKYGLAAAVFTKDIDKANYVSSGLRAGTVWINCYDVFG
AQAPFGGYKASGVGRELGQYGLENYTEVKTVTIKIPQKNS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcggactgcgctccgccgtctttcgggctgtgaccccgctgagccgggtgttggcg
tgtcgcttctccgcagctccaatcccggttccgaacactcaaccagaggtccactacaac
aagctcttcataaacaaccggtggcaggacgcagaaagcgggaaaacctttccaaccatc
aatccagcgaccggagaggtgatctgccaggttgccgaggcggatgagtctgatgtaaac
aaggcagtgaaggcagcatctgacgccttcagactgggatcgccatggcgacgcatggat
gcctctcatcgtggccttctgctcaaccgattagctgatgccatagagagggatgcagcc
tacctagctgaactggagactctggacaatggcaaaccctatgcagtggcttattctgtg
gacttgcctaatgtggttaaatgtctcaggtactatgcaggctgggctgataagtgggaa
gggaagaccatccccatcgatggagattatttctgctacaccagacatgaacccgtgggg
gtctgtggacagatcattccatggaacttccctttgctgatgcaagcctggaagctgggt
cctgccctcgccactgggaacacggtggttatgaaggtcgcagagcagacgccgctgacc
gcgctctacgtggccagtctcattaaggaggtgggtttccctgaaggtgttgtaaatatc
ctgccgggaatgggaccaacagccggtgctgccattgccaggcacatggatgtagataaa
gtggccttcactggatcaacagaagtgggtcacctcatccaacaagcttcaggaagcagt
aacctgaagcgagttaccctggagctcggaggaaagagtccaaacatcgttttgtcagat
gccaacatggaagatgctgtggagcagtcccactttgctctgttcttcaaccagggccag
tgctgctgtgctggctctcgcacgtacgtccaagcagacatctatgatgagtttgtggag
cgcagcgttgagcgtgctaaaagaagagtggtgggagacccctttgacatgaagactgag
cagggccctcaggtcgatcaggagcagttcaacaagatcctgggctacatcagcagtggg
aaaagagaaggagccaagttgatgtgtggaggcggcgtggcagcagacagaggatacttc
atccagcccacagtatttggagatgttcaggataacatgaccattgccagagaggagatt
tttggtccagtgatgcagattttcaagtttaaaactttggaagaggttctaacgagagcc
aatgacagcaagtatggcctcgcagctgccgtcttcacaaaagacatcgacaaagccaac
tacgtgtctagtggacttcgcgccggcaccgtctggatcaactgctatgatgtgtttgga
gctcaggccccattcggaggttacaaagcttctggagttggcagagagctcgggcagtac
ggcctggaaaactacactgaagtcaaaacggtgaccatcaagataccccagaagaattct
tag

DBGET integrated database retrieval system