KEGG   Oryzias latipes (Japanese medaka): 101172757
Entry
101172757         CDS       T02443                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04060  Cytokine-cytokine receptor interaction
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04217  Necroptosis
ola05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101172757
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101172757
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101172757
   04217 Necroptosis
    101172757
   04115 p53 signaling pathway
    101172757
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    101172757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ola04050]
    101172757
   04090 CD molecules [BR:ola04090]
    101172757
Cytokine receptors [BR:ola04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101172757
CD molecules [BR:ola04090]
 Proteins
  101172757
SSDB
Motif
Pfam: TNFR_c6 Death PepSY_TM ECSCR stn_TNFRSF12A
Other DBs
NCBI-GeneID: 101172757
NCBI-ProteinID: XP_004077397
UniProt: A0A3B3I4V5
LinkDB
Position
15
AA seq 310 aa
MATTGLKNVWIYFLLLAIGTLVPSTSANIQVPNAGVCADGNYTHDGKTCCLCAPGQRVLK
HCTDSPTNGECVFCEEGKTYREEPNSQTTCELCDSCSHPNANLEVVERCTTSRNAKCGCQ
KGYYCDSEKGSCVVCQSCDICESTGIKIACNGTSNTVCNESQGISGGAIAGIVIVIILAI
LAAGVVLWWKKTRKPSDGAEPDSEELEYLNEVDIKPHLADIAQILGWKDMLYIARKSKML
DTTIDSCQLNHPNDTEESTVELLQKWSEIKGRTGVRSLVQMLNASRKQDKKERILKLIKN
DTNNECSNPV
NT seq 933 nt   +upstreamnt  +downstreamnt
atggcgacgaccggcttaaaaaacgtttggatctattttctacttttggcaataggaaca
ttggtacctagtacgagtgccaacattcaggtcccaaatgctggtgtttgtgcggatgga
aactacacacacgacggtaaaacgtgctgcctctgtgctcctggtcagagagtcctaaaa
cattgcacggatagcccaactaatggtgaatgtgtcttctgtgaagaaggcaaaacatac
agagaggagccaaacagccaaacaacgtgtgagctctgtgactcctgctcacaccccaac
gccaatttggaagtggtggaacgctgtaccacttcaagaaatgccaaatgtggatgtcag
aagggctactattgcgacagtgagaagggaagctgtgtggtctgccagtcttgtgatata
tgtgaatccactggcatcaaaatagcctgtaatggtaccagcaacacagtgtgcaatgaa
agccaaggtataagtggtggagcaattgctggaatcgtcatcgttatcattttggcaatc
ctagctgctggggttgtactttggtggaaaaaaacaagaaagccaagcgatggagctgaa
ccagacagcgaggaacttgagtatctcaacgaagtggacatcaagcctcacctggctgac
atcgcgcaaattctgggatggaaagatatgttgtatatcgcaaggaaaagtaaaatgtta
gacaccaccattgattcttgccagttgaaccatccaaacgacaccgaggagagcaccgtc
gagctgttacagaaatggtcagagataaaaggcagaactggagtgaggtcgctggttcag
atgctcaatgcatccagaaagcaagacaagaaagaaaggattttaaagttgatcaaaaat
gacaccaacaatgaatgtagcaatcctgtttga

DBGET integrated database retrieval system