KEGG   Oryzias latipes (Japanese medaka): 101172804
Entry
101172804         CDS       T02443                                 

Gene name
zmat3
Definition
(RefSeq) zinc finger matrin-type protein 3
  KO
K10137  zinc finger, matrin type 3
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101172804 (zmat3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz zf-C2H2_2 TUTase zf-U1
Other DBs
NCBI-GeneID: 101172804
NCBI-ProteinID: XP_011472485
UniProt: H2M7P2
LinkDB
Position
4
AA seq 490 aa
MMALQLRSGDAAYYQSAGFCPNYTSQPVRYGDSSHYFAQLPGTEAMMKPPLSLFSHPQQP
FQHMDSLHPLGPPPMAPTQPLGLPHINPAQAIGPPTMGPAQGLGAHLTASHTLRPPPITP
QHTLGPPPMPPGQPPMAHTLGPPPGNPTQAILRPTIDLTQQLGPPHLTPARALVPPTVVT
QAAGRFSLPPSSLSSTPTPSPGASQMLPRPPGPALIPAPVSRPACGPPPAQAAPPSELDI
DEGSSVGMEEQEDSMGLEELCKPLYCKLCNVTLNSAQQAQAHYQGKNHSKKLRNFYAGSK
QPPAIRIPEALEGVGQTGFVLGSGDADAGKQGLYKGAPRVILATENDYCKLCDASFSSLA
VAQAHYQGKNHAKRLRLAEAQQNSNNIESSTETVPRRNRKDGSEYRLVKNRRSPQMAATM
QGPYYNPRPRQRIPRDLAMCVTPSGQFYCSMCNCGAEQETDFRQHLESKQHKAKVSELRY
RNEMENLGYS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgatggcgttgcagctcaggagcggggatgcagcctattaccagagtgcggggttctgc
ccaaactacacttcgcagcccgtccgctacggtgacagcagccattattttgcacaatta
ccaggtactgaagccatgatgaagcctcctttgagtttgtttagccatccccagcagcct
ttccaacacatggactcccttcaccctttggggcctccgccaatggcacctacacaacct
cttggcttaccacacattaaccctgctcaggcaatcggaccgccgacaatgggtcctgcc
cagggtctaggagctcacttaactgcctctcacactttaagacctccacctattacccca
caacacaccttgggcccccctccgatgcccccagggcaacccccaatggcacacactctc
ggacctccacctggaaaccccactcaggcaatactacgtcccacaattgatctgacacag
cagctggggcctccacatttgactcccgcccgagcattggtgcccccgactgtagtgacg
caagcggccggacgattttcccttcctccaagctctttatcatcaactcctactccaagc
cctggggcttcccagatgctcccaaggccgccaggaccagccttaatcccagccccagtg
tccaggcctgcatgcggtccaccaccagctcaggcagccccacccagtgagctggacatt
gatgagggttcatcagtggggatggaggagcaagaagactctatgggcttggaagaactt
tgtaaaccactgtattgtaaactctgcaacgttacactcaactctgcacagcaggcacag
gctcactaccagggaaagaaccacagtaaaaagttacgaaacttctacgctggtagtaaa
cagccgccagcaatcagaatcccagaagcccttgaaggtgtgggtcagacggggttcgtc
ttaggatccggagatgctgatgctggaaagcaagggctgtataagggggcaccccgagtc
atcttggctacagaaaacgactattgcaaactgtgtgacgcctccttcagctccctggca
gtcgcacaggctcactaccaaggcaagaaccatgcaaagaggctacgactggccgaggcc
caacagaactctaacaacatagaaagcagcactgagacagtcccaagaagaaaccgaaaa
gatggcagtgaatacagactggtgaaaaaccgccgcagtcctcagatggctgctaccatg
caagggccgtactacaaccctcggccgaggcagcgcatccccagagacttggccatgtgc
gtgactcccagcggacagttctactgctctatgtgcaactgtggcgctgaacaggagaca
gacttcaggcaacatctggagagcaaacagcacaaagccaaagtgtcagagttacgctat
cgcaacgagatggagaacctcggctacagctaa

DBGET integrated database retrieval system