KEGG   Oryzias latipes (Japanese medaka): 101172833
Entry
101172833         CDS       T02443                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04060  Cytokine-cytokine receptor interaction
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04217  Necroptosis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101172833
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101172833
   04217 Necroptosis
    101172833
   04115 p53 signaling pathway
    101172833
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101172833
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ola04050]
    101172833
   04090 CD molecules [BR:ola04090]
    101172833
Cytokine receptors [BR:ola04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101172833
CD molecules [BR:ola04090]
 Proteins
  101172833
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 101172833
NCBI-ProteinID: XP_011479782
UniProt: A0A3B3HLQ6
LinkDB
Position
12
AA seq 447 aa
MNFGPVLGGLWVVALFAGLVCHAAEPPASQRSAGVHRNATLRQHQAQCVENQQYPHQGLC
CLNCQAGTFVKKPCERDQQQGICEPCEHGQTHTEHSNGMGRCLPCNHCRQDQIEVAACTV
TTNTRCQCKPGTFCAPEQACEVCKRCAKCKAGEEEVKKCTPFSNTVCQKRGPSSTEPAPV
RPSPTSASASQTHLVLYVFLLLLVAIIVGVAIWWFKGRPSCQTPCVKSHCQSSEIVKIPI
DETTNRPEERQNKQNSGLECEEPRPESRPLLQETQVGMTKASPPLEDEDRGLGDSLPNTT
SSSQTSLSALPPTAASSGSTPRHSPSAFRHLPADMDDPLKHRLVPLLGSEKSLRKSFDLF
DEYLDVRIHNKFFRLIGISDNHIRIAENGAAADKVYELLKNWMQKQGLKADINNLLDALL
SLDQRRSAECIAYEALRKGYYRHADVL
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgaacttcggaccggtgctcgggggactctgggtggtggcgctcttcgcggggctcgtc
tgccacgcagcagagcccccggcatctcagcggtccgccggcgtccacagaaacgccact
cttcggcagcatcaggcgcagtgtgtggagaaccagcagtacccccaccaggggctgtgc
tgcctcaactgccaggccggaacatttgtgaagaagccctgtgaaagagaccagcagcag
gggatctgtgagccctgcgagcacggccagacgcacaccgagcactccaacgggatgggc
cgctgtctgccgtgcaaccactgtcgccaagatcagattgaagtagcggcgtgcaccgtg
accacaaacaccaggtgtcagtgcaagccgggcactttctgtgctccagagcaggcctgc
gaagtctgcaaacgctgcgccaagtgtaaggcgggtgaggaggaggtgaagaagtgcacc
ccgttttctaacaccgtttgccaaaaacggggcccgtcctccaccgaacctgcgccagtg
cgcccctccccgacctcggcttcagcctcccaaacccacctggtcctttatgtctttctc
ctcctgctcgttgccatcatcgtgggggtcgctatttggtggtttaaaggcagaccctca
tgtcaaacaccatgcgtgaagagtcactgtcagagcagcgaaatcgtcaagattcccatc
gacgagaccacaaaccgtccagaggagcggcagaacaagcagaactcgggtttggagtgc
gaggagccccgccccgagtcgcggccgcttttgcaggagacccaggtcgggatgacgaag
gcgtcccctccgctcgaagacgaggaccgcggactcggagacagcttgcccaacacgacc
agctcgtctcaaaccagtctgtcggctctgccccccactgcagcgtcctcgggcagcacc
ccccgccacagcccctcggccttcagacatctgcctgcagacatggatgaccccctaaaa
catcgactcgtgccgctactagggtcagagaagtccttaaggaagagctttgacctgttt
gatgaatatctggacgtgcggatccacaacaagttcttccgactgattggcatcagcgac
aaccacattcggatcgcagagaacggcgccgccgccgacaaagtctacgaactgctgaag
aactggatgcagaagcagggactgaaggccgacatcaacaacctgctggacgctctgctc
agtctggaccagcgccgctcggcggagtgcatcgcctacgaggccctcagaaagggctac
tataggcacgcagacgtgctgtga

KEGG   Oryzias latipes (Japanese medaka): 101173230
Entry
101173230         CDS       T02443                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 22
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04060  Cytokine-cytokine receptor interaction
ola04115  p53 signaling pathway
ola04210  Apoptosis
ola04217  Necroptosis
ola05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101173230
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101173230
   04217 Necroptosis
    101173230
   04115 p53 signaling pathway
    101173230
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101173230
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ola04050]
    101173230
   04090 CD molecules [BR:ola04090]
    101173230
Cytokine receptors [BR:ola04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101173230
CD molecules [BR:ola04090]
 Proteins
  101173230
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 101173230
NCBI-ProteinID: XP_004072941
UniProt: A0A3B3IN84
LinkDB
Position
9
AA seq 340 aa
MEVCRFMVSVGCLAFLVTLTAANLPPGLRVRRRRHFGACGEQEYPNGNICCLNCKAGTFV
KSSCTAAGQRGTCEECDYGTFTEHDNHLQKCVDCAKCGPDQEVAEQCTNTQNTKCRCKAG
RFCNPEEACEVCRKCLTCKSDEEIVRNCTFTSNTVCKKIPLKPGSSLDAVFFVLCVIPVV
LFLVAGGIFLKYKKKCGCRGSSQASPTVAKSEENCGGRGSSAALILLSEEEQLPTLIPVN
GEQSLRSCFELFEELDVDFHKKFFRRLDFSDNAIKSKDNLLYEDKIHELLNSWVEREGKK
ANLNELLKVLVELNQKRTAEKIMKKVLDNGQYCTESKDEV
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggaggtctgtcggttcatggtttcagtgggctgtcttgcgtttcttgtcacattgaca
gcggcgaacctcccgcctggattgagagtcagaagacgacgacattttggcgcctgtgga
gagcaggagtacccgaacggcaacatttgctgcctcaactgtaaagctggcacctttgtg
aaatcgtcttgcaccgctgcaggacagaggggcacatgtgaagaatgcgactacggaacg
ttcaccgaacatgacaaccatttacaaaaatgcgttgactgtgcaaagtgtggtccagat
caggaagtagccgagcaatgcaccaacacccagaacactaaatgtcgatgcaaagcagga
aggttttgtaaccctgaagaggcatgtgaagtctgcaggaagtgtttgacgtgtaagagt
gatgaggagatagtgaggaactgcacatttaccagcaacaccgtgtgcaagaaaatccca
ctgaagccaggatcctccttagatgctgtattttttgtcctctgcgtgatacctgttgta
ttatttttggttgctggaggaatatttctcaaatacaagaagaaatgtggatgtagaggc
tcttcccaagcctctcctacagttgcaaaatcggaggagaattgcggtggcagaggcagc
agcgcagctctgattttgctatcggaagaagagcaactcccaacactcattcccgtgaat
ggtgaacagtctctccgaagttgctttgagttgtttgaagaactggacgtggattttcac
aagaagttcttccgccgcctcgacttctcggacaacgcgatcaaaagcaaagacaacctt
ctttacgaagacaaaattcacgagctcctgaactcctgggtggagcgagaaggcaaaaaa
gccaatttaaatgaactgcttaaagtgttggttgagctaaaccagaagagaacagctgag
aagatcatgaagaaggttcttgacaacggtcagtactgcaccgagtccaaagatgaagtc
taa

DBGET integrated database retrieval system