KEGG   Oryzias latipes (Japanese medaka): 101173517
Entry
101173517         CDS       T02443                                 

Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X3
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04020  Calcium signaling pathway
ola04260  Cardiac muscle contraction
ola04261  Adrenergic signaling in cardiomyocytes
ola04270  Vascular smooth muscle contraction
ola04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101173517
   04020 Calcium signaling pathway
    101173517
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101173517
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101173517
   04261 Adrenergic signaling in cardiomyocytes
    101173517
   04270 Vascular smooth muscle contraction
    101173517
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ola04040]
    101173517
Ion channels [BR:ola04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101173517
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Rer1
Other DBs
NCBI-GeneID: 101173517
NCBI-ProteinID: XP_020569914
LinkDB
Position
23
AA seq 2303 aa
MIRGLFQRKPKHERLKEEPEVRFKGLLVSERDLGYTYVRPGGSDYSPPTLPRPPHPGLTN
EHSGVESHGDRSGGGGGPNHGVGVVGLAPEHIPTPGAALSWQAAIDAARQAKMMGNAASG
GGTGLGSGGGGPISTASSTQRKRQHYSAKPKKQTTTTATRPPRALLCLTLKNPIRRACIS
IVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVI
AYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGATPIGGKAAGFDVKALRAF
RVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCV
HNHTGLNAEEKPAPCAPDGAYGRHCTQNGTQCRVGWEGPNDGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGLDDDKPRNRKNHHFLSLRGAVKKNA
AFLRKALSMPASENESVNTDNPPGGDVEGETCCTRLAIRISKSKFSRYSRRWNRLFRRKC
RAAVKSQVFYWLVIFLVFLNTLTIASEHHRQPQWLTDVQDIANKVLLALFTGEMLLKMYS
LGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSL
SNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETRRSTFDNFPQSLLTV
FQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADA
ESLTSAQKEEEEAKERKKLARLASPKKHEENEKPPLEEKKSEKIELKSITSDGETNPATK
ISMDDCCGDENEEKNPYPANDYIGDDDEEEPEMPVGPRPRPLSDIHLKEKAVPMPEARAF
FVFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADHVF
TGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVL
RVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTD
SSKQTQAECRGSYIMYKDGDVGKPGRSPRVWENSDFNFDDVLQGMMALFAVSTFEGWPGL
LYRAIDSHSEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNC
ELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQH
HGQTKNFNDAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVIL
SEINGLQNSEENARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIV
MLFFIYAVIGMQMFGKIALRDLSQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPN
RPCEKGSTNENSTASEECGSQFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSIL
GPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMP
LNSDGTVMFNATLFALVRTALRIKTDGNLEQANEELRAIVKKIWKRTSMKLLDQVVPPAG
DDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKVPPKTALSLQAGLRTLHDIGPEIRRAI
SGDLNVEEEMDKGMKEPVSAASEDDIFRVKRSGGLFGNHVNYYNQSDGRSSFPQSFTTQR
PLHISQKGSPCEGESPSHEKLMDSTTFTPSSYSSSGSNANINNANNTSVTGVANQGVSRF
PSPSISTVDGHTGQPLTPILLPRSAWCFPPKRMFYDTLMRSDSSDSHLPIIRRGEGSTEE
TYDESYGDDREYHEDDHSLSSDMLVYHDDTCRQLTPMEEAEEVEGRRGSGGWQSPRRVFL
CPTSLGRRSSFHLECLRRQPRPEVSQKTSAPLHLVHHQALAVAGLSPQLRRSHSPNLFSR
LCSTPPASPAAHCSDASYQGVPSLRLEGSNSHEKLNTSLPSVSCGPWYSDSNGNSRVPSP
SPSVSASSQRAPRPVSLTVPSLLGKDSTSLSHGSAGSLVEAVLISEGLGHFAQDPSFIEA
TKVELADACDMTIEEMEQAANNILNGKNASNPSPSTSSTSQHSPNGSLHPFHTTAASTQR
DRVAGLTSSEDGAEAAGNRISIHGPSSIEERQELLATERGQEEEEEEVTRREKHHRNSAV
IAGARQRDSGLLEDEDMECVTSL
NT seq 6912 nt   +upstreamnt  +downstreamnt
atgattagaggtctgtttcagagaaaaccgaaacatgagaggctgaaggaggaacctgaa
gtccgatttaagggcttgttggtgtcagagagagacctgggatatacatacgtccgacct
ggaggctccgattactctccccctacgcttcctcgtccccctcatccaggcctgacaaac
gagcacagtggtgtcgagagccatggcgatcgaagtggaggagggggcgggcccaaccac
ggagtgggtgtggttggtcttgcacctgagcacatccccacaccaggggcagccctgagc
tggcaggcggccatcgatgctgcgcggcaggcaaagatgatgggcaatgccgcgtcaggt
ggaggaacaggacttgggtcgggagggggcgggcccatctctacggccagttccacgcaa
aggaaaagacagcattatagcgccaaacccaagaaacagaccacaacgacagccacaagg
ccgccgcgggctctgctctgtctcacactcaagaaccctatccgcagagcctgcatcagc
atcgtagagtggaaaccatttgagatcatcatcctgatgaccatctttgctaactgtgtg
gccttagccgtctacatcccttttcccgaggatgactcgaatgccaccaactccaacctg
gagcgcgtggagtatctgttcctcatcatttttacagtggaggcgttcctgaaggttata
gcctacggcctgctcttccaccccaacgcctacctgaggaatggctggaatctgctcgac
tttatcattgtagttgtagggttattcagtgcaattctggagcaggccacaaagggggat
ggggccactcctattggaggaaaggcagccggtttcgatgtcaaggctctgagagctttc
agagtactcagacctctaagactggtctccggagtaccgagtttacaggtagtgttgaac
tctataatcaaagccatggtccctctgctccatattgccctgttggtcctctttgtcatc
atcatctatgccataattggcctggagctcttcatgggcaagatgcacaagacctgcgtt
cacaaccacacaggcctaaatgcagaggaaaagccagcaccgtgcgctcctgatggtgcc
tacggccgacactgcacacagaatggaacccagtgcagagtgggatgggagggtccaaac
gatggcatcaccaactttgacaactttgcctttgccatgttaacagtgtttcagtgtata
acaatggaaggctggacagacgtgttgtactggatgcaggatgctatgggctatgagctg
ccatgggtctattttgtctctctcgtcatcttcggctcttttttcgttctcaatctcgtt
ctgggggtgttgagcggagagttttctaaggaaagagagaaggccaaagcacgcggtgac
ttccagaaactcagagaaaaacagcagctagaggaagacctaaagggctatttagactgg
atcactcaggctgaagacattgacccagaaaacgaagaggagggtttagatgacgacaaa
ccaagaaaccgtaaaaatcatcattttctctctcttcgtggagcagtgaagaaaaatgcg
gctttccttcgtaaggcgttgagcatgccagccagtgagaatgagtcagtcaacacagac
aaccccccagggggagatgtagagggggagacctgctgcacccggctagcaattaggatc
tccaaatccaagttcagccgttactcccgaagatggaacaggctgttcaggaggaagtgc
cgtgcagctgtcaaatcccaggttttctattggctggtcatcttcctggttttcctcaac
actctgaccattgcttctgaacatcaccggcagcctcagtggctcacagatgtacaagac
atagccaataaagtattactagcacttttcactggtgagatgctgttaaagatgtacagt
cttggtctccaggcatactttgtttccctcttcaatcggtttgacagtttcgtagtgtgc
ggaggaatcctggagacaattttagtagaaacaaagatcatgtctcctctcggcatttct
gtcttacgatgtgtacgcttgctcagaatcttcaaaataaccaggtattggaactccctg
tccaacctggtggcttccctgctgaactctgttcgatccatcgcctccctgctcctcctg
ctcttcctcttcatcattattttttccctgctgggcatgcagctttttgggggaaagttc
aactttgacgagacaaggcgcagcacctttgacaactttccccagtctttgctcaccgtg
tttcagattctaacaggagaggactggaactctgtgatgtatgatggcattatggcgtat
ggtggtccgtcttttccgggcatgctggtctgcatctatttcatcattctgttcatctgc
ggaaactatatcctactgaatgtcttcttggccattgctgtcgacaatctggcagatgca
gagagtctgacctcagcccagaaggaggaggaagaggcaaaggagaggaagaaactggcc
aggcttgctagtcctaagaaacatgaagagaatgaaaaaccacctttagaagaaaagaag
agtgaaaagatagagctgaagtcaattacctcagatggagaaaccaatccagctacaaag
atcagcatggatgactgctgtggagatgagaatgaagaaaagaacccataccctgcaaat
gattacattggcgatgatgatgaggaggagccagaaatgccagtgggcccaaggccgcgt
ccactctctgacatccatctaaaggagaaggccgttcccatgcctgaggcccgcgcattc
ttcgtcttcagccacactaacaaattcagggttctgtgccataagatcgtcaaccacaac
atcttcaccaacctcatcctcttcttcatcctgctcagcagcatcagtctcgcggcagag
gacccagtcaagaacgactcattcagaaaccagatcctggggtatgcagaccatgtcttc
actggactcttcacgatagaaattattcttaagatgacggcttatggagccttccttcac
aaaggctcattctgtagaaactatttcaacatcctggacttagttgtggtcagtgtgtcc
ctcatctcctctggaatacagtccagtgcaattaatgttgtaaagatcttgagagtcctg
cgagtgctccgaccactgagggccatcaacagagccaaaggactgaagcatgtggtgcag
tgcgtgtttgtggcaatcaggaccattggcaacatcgtcatcgtcaccacgttgctccag
ttcatgttcgcttgtattggagtgcaactctttaaggggaagtttttctactgcacggac
agctccaagcagactcaggcagagtgcaggggttcctacatcatgtataaagatggagac
gtgggaaagccaggaagatccccaagagtttgggagaacagtgacttcaactttgacgat
gttctgcaaggcatgatggctttgtttgcagtgtctacttttgagggctggcctgggtta
ctgtaccgagccatagactctcattctgaggatgttgggcccatctacaactaccgtgtg
gtcatttccatcttcttcatcatttacatcatcatcattgcttttttcatgatgaacatc
ttcgtcggtttcgtcatcgtcacattccaggagcagggggagcaagaatataagaactgt
gagctggacaagaaccagcgtcagtgtgtggagtatgccctcaaggctcgtcctctgcgc
cgctacatccccaagaacccataccagtacaaggtgtggtatgtggtcaactccacctac
tttgagtacctgatgttcacactcattcttctcaacaccatctgtctggccatgcagcat
catgggcagaccaaaaacttcaatgatgcaatgaacatcctcaacatgcttttcactggg
ctgttcactgtcgaaatgatccttaagctcatcgccttcaaacccagggggtactttagt
gatccctggaatgtgtttgatttcctcatcgtaattggcagcataatagacgtcattctc
agtgaaatcaacggactgcagaactcagaagagaacgccaggatctccatcaccttcttc
cgactgttccgcgtgatgaggctggtgaagctgctttctcgcggggaagggattcggacc
ctgctgtggaccttcatcaaatctttccaagccctgccctacgtagctctgcttatagtg
atgctcttcttcatatacgctgtcattggcatgcagatgtttggtaaaatagcgttgcgg
gatctctcacaaatcaacaggaacaacaacttccagacattccctcaagcagtgctgctg
ctcttcagatgtgcgacaggcgaggcatggcaggagatcatgctggcgtgttcacccaac
cgaccctgtgagaaagggtcaaccaatgaaaacagcaccgccagtgaggaatgtggcagc
cagtttgccatcatttacttcgtcagcttctacatgctttgtgcctttttgatcatcaat
ctatttgtggctgtaattatggacaactttgactacctgacacgggattggtcgatcttg
ggaccgcaccatcttgatgaattcaaaagaatctgggctgaatatgacccagaagctaag
ggtcgaataaaacatcttgatgtagtcactttgctgcggagaattcagcctcctctggga
tttggaaagctctgcccacacagggtggcttgcaagcgtctggtgtcaatgaacatgcct
ctgaacagcgatggaacggtgatgttcaatgccacactgttcgcattggtcagaactgcc
ctcagaatcaaaactgacggaaacttggagcaagctaatgaggaactgagggcaattgta
aaaaagatctggaaaagaacaagcatgaaactcctggatcaagtagtgccccctgctggt
gatgatgaggttacagtcgggaagttctatgctactttcctcatccaagagtatttccgc
aagtttaagaagaggaaagaacaggggctggtgggcaaggtgccccccaaaactgcactc
tctctgcaggcaggcctgcggacattgcatgacattggtccagagattagaagggccatc
tcgggagacctgaatgtggaggaggaaatggataaagggatgaaggaacctgtgtcagca
gcatctgaggatgatatcttcagggtaaagcgttctggtggcttgtttggcaaccatgtc
aactactacaaccaaagcgatggccgcagctccttcccacagtcctttaccacccagcgt
cctttgcatatcagccagaaaggctccccttgcgaaggcgaaagcccatcccacgagaaa
cttatggactcaaccacctttaccccttcctcctactcatcatcaggctccaacgccaac
atcaacaacgccaacaacaccagcgtgactggcgtggccaaccagggtgtcagtcgattt
ccgagcccttctataagcactgtagatggacacactgggcagccactgacacccatcctg
ctgccaaggtccgcatggtgcttccctccaaaaaggatgttttatgacaccctcatgcgc
tccgactccagtgacagtcatctgccaatcatccggagaggggaggggtcaacagaggag
acgtatgatgagagctatggtgacgacagagagtaccacgaagatgatcactcgctttcg
tctgacatgttggtgtatcatgatgacacatgcaggcagctaactcccatggaggaagca
gaagaagtagaaggaagaagaggaagtggagggtggcagtctccacgaagagtcttcctc
tgtccaacctctctgggacggagatcgtccttccacctggagtgtctccggagacaacca
aggccagaagtctctcagaagacgtctgcacctttacatcttgtacatcaccaggctcta
gcagtggccgggttgagtcctcagctgagaaggagtcactcacccaacctgtttagccgg
ctgtgctcaacgcctccagccagtcctgcagcccactgcagtgatgcctcctatcaggga
gttccctctttgaggctagagggctccaactctcatgaaaagctcaataccagcttgcct
tctgtcagctgtgggccctggtacagcgacagtaacgggaacagccgggtacccagcccc
agccccagcgtgtcagcgtccagtcaaagagctccacggccagtgtcgctcaccgtaccc
tcacttttggggaaggactccacttcgctgtctcatgggagcgcgggcagtctggtagaa
gcggtcctgatatcagaaggtttgggccatttcgcccaggatccttcgttcattgaggca
accaaagtcgagttggctgatgcctgcgacatgacaatagaggaaatggaacaggctgcc
aacaacattctcaatggcaagaatgcctcaaacccctcacccagcacctcttccacctct
cagcacagtccaaacggcagccttcatcccttccacacaacagcagcatcaacacaaagg
gaccgagtggctggcttgacctctagcgaagatggggcagaagctgcaggaaacagaatc
tccatacatgggccgtcctctatagaggagcggcaggagttgctagccacggaaagaggc
caagaagaggaggaggaagaggtgacgcggagggaaaagcaccatagaaattctgctgtc
attgcaggagcgcgacagagggacagtgggcttttggaggacgaggatatggaatgtgta
acgagtttgtag

DBGET integrated database retrieval system