KEGG   Oryzias latipes (Japanese medaka): 101173844
Entry
101173844         CDS       T02443                                 

Definition
(RefSeq) G2 and S phase-expressed protein 1 isoform X1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101173844
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 101173844
NCBI-ProteinID: XP_004086315
UniProt: H2MYW2
LinkDB
Position
6
AA seq 693 aa
MWDRTGTYKKKNFRGDQTTMAFEAKSVSKADVLFLQDEKFDFDVSLSPASSKDDEDEVFE
GPVEGEESRVSVSKASELLEGDHVFSNWSPLTGERLDAVCQEAHSLVNQLQDGKACGVED
ANIAGEQFLQDSEAKKKVLCSSSGALSPIKRQTFCVQDTPTKQLPPAIQLQLPRGSRRSS
AAPLSAARSTSSPVGGAKLQPRSNLRAKAPVGVAVVLPSKAVAPPASRLTSRADRTRLQP
PIKAVSKRSPSSRLANRAESCEDLLSDAASVASDISDSSINSTLSLTRTLAPPSKRVVGK
NHSGGKAPTIPGRKVTDRKNTSSSSSSVSSFNSSLSLSPAKGKLNSSVNQSFSSSARNAP
SGVNRSTNDRRPRRSTVYAATEQQSTKTLHQARKISECPKKSTPLKRAESVTFQPTPSKR
LLEKTASMPSSVSSLLPGRLKSKPEALVFPTPGVRHTDASSDISKGLKPKRLVSFGSMNS
VPIKPSAAHLMPSESVPKSVQGKARRPSGLPTPVRSRSFAFSNSLTPRVKPSVVTDSCTA
PTPSSALKHLSSSRLPRDAPLEEHVDPPDIPPFRLEEEEAPVTTSCESSEPHPPENKEDV
EPTTPTLPKNLIEMETAEENTGKTQEVLLLDLPAPAPNPTEKLLIDLTNTPDLIRKSTKS
CTETQLIDLSSPLIKWSPDSKHENNAPLINLSF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgtgggacagaacgggaacatacaagaaaaagaacttcagaggagatcaaacaacgatg
gcctttgaagccaagagcgtttcgaaagcagatgtgcttttcctgcaagacgagaagttt
gatttcgacgtttctctttcccctgccagctctaaagatgatgaagacgaggtttttgag
ggtccagtggagggtgaagagtctcgtgtttctgtgagcaaagcctctgagcttctggaa
ggagatcacgtgttttcaaactggagcccactcacaggtgagcggctggatgctgtgtgt
caggaagcccactccctggttaatcaactgcaggatggaaaagcgtgcggcgtggaggac
gccaacatcgctggagaacagtttcttcaggactctgaggcaaaaaagaaagtgctttgt
agttcgagcggcgctctcagccccatcaagcggcagactttctgcgtgcaggacacgccc
acaaagcagctgccgcctgccatccagctccaattgcccagaggaagccggcgcagctcg
gccgctcccctctctgccgcacgcagcacctccagccctgtgggtggagccaagcttcag
ccgcggtctaacctgcgggcaaaagcgccggtgggggtcgccgtggttttaccgagcaag
gcagtcgctccaccggcttccaggttaaccagcagagcggacagaacaaggctgcagcca
ccaatcaaagccgtgtcaaagcgcagcccgtcttcacgcctcgccaacagagccgagtca
tgtgaagatttactctctgatgcagcaagtgtggcgtctgacatcagtgactcctccatc
aactccaccctgtcactgacgcgcactctggcaccgccctcaaagagggtcgtggggaag
aaccactctggaggtaaagctccaaccattccaggccggaaggtgacagacaggaagaac
acctcctcatcttcatcgtctgtgtccagcttcaactccagcctgtccttgtcccccgcc
aaaggtaaactgaactcctctgtgaaccagagtttcagcagctcggctcgaaatgccccc
agtggagtaaaccgatcaaccaacgaccgtagacctcgccgttccaccgtttacgccgcc
accgagcagcagtccacgaagactctgcaccaagccaggaagatctctgaatgccccaag
aagtccacgccgctgaagagagctgagagtgtgacctttcaaccaacaccctccaagagg
cttttagagaagactgcgtccatgccctcctcggtatccagcctgctgccaggaagattg
aagtccaagccggaagccctggtgtttcccacgccaggagtccggcacacggatgcgtca
tcagacatttcaaaggggctcaagccaaaaaggctggtgtcatttggcagcatgaacagt
gttccgataaagccatccgctgctcatctgatgccatctgaaagcgtccccaagtcggtg
cagggaaaggcccgccgcccatctggccttcctaccccagtgaggagcaggtcttttgcc
ttctccaacagcctaacccccagagtgaagccatcggtggtcacagactcctgcacagct
cccactcccagttcagccctcaaacacctcagctccagccgccttcctagagatgctccg
ctggaggagcatgttgacccccctgacatcccacctttccgtctggaggaagaggaggcc
cctgtcaccacatcatgcgagagctctgagcctcaccccccagagaacaaggaggatgtg
gagccaacaacccccacgctgcccaagaacctgatcgagatggagactgcagaggaaaac
accggcaagacccaggaggtcctcctccttgaccttccagctccagcgccgaatcctaca
gagaagctgcttattgacctcactaacaccccagacctgatccgcaaaagcaccaagagc
tgcactgaaactcagctgattgatttgagttctccactcatcaagtggagtccagacagc
aagcatgagaacaacgcgcctctaatcaatctgtccttctga

DBGET integrated database retrieval system