KEGG   Oryzias latipes (Japanese medaka): 101174339Help
Entry
101174339         CDS       T02443                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00010  Glycolysis / Gluconeogenesis
ola00030  Pentose phosphate pathway
ola00051  Fructose and mannose metabolism
ola00052  Galactose metabolism
ola01100  Metabolic pathways
ola01200  Carbon metabolism
ola01230  Biosynthesis of amino acids
ola03018  RNA degradation
Module
ola_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101174339
   00030 Pentose phosphate pathway
    101174339
   00051 Fructose and mannose metabolism
    101174339
   00052 Galactose metabolism
    101174339
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101174339
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ola01009]
    101174339
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ola03019]
    101174339
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101174339
Protein phosphatases and associated proteins [BR:ola01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101174339
Messenger RNA biogenesis [BR:ola03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101174339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101174339
NCBI-ProteinID: XP_004068614
UniProt: A0A3B3IKM0
LinkDB All DBs
Position
5
AA seq 777 aa AA seqDB search
MAQQAPIDPTKIGEGRAIAVLTSGGDAQGMNAAVRATVRVGLYTGAKVYFVHEGYQGLVD
GGDHIRPATWESVSMMLQLGGTVIGSARCQDFRSKEGRTKAAYNLVKLGITNLCVIGGDG
SLTGANQFRTEWKDLLADLIKAGKITANEAKNSSHLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPEEGWE
DHLCRRLTEQRGRGSRLNIIIVAEGAIDRHGKPITCDLVKQLVSKKLGFDTRTTILGHVQ
RGGTPSAFDRILASRMGVEAVMALLEATPDTPACVVSLSGNMAVRLPLMECVQVTKDVMT
AMAEGRFDEAVNLRGKSFENNWNTYKMLAHVHPPETKSNINIAILNVGAPCAGMNAAVRA
AVRIGLLQGHQMLAVHDSFDGLAHGMIEPITWSGVAGWTGKGGSILGTKRSLPHEFMEEI
SLSITKFNIHGLVIIGGFEAFLGGLEMVQAREKYEELCIPLVVVPATVSNNVPGTDFSIG
ADTALNTITMTCDRIKQSAAGTKRRVFIVETMGGFCGYLATMAGLASGADAAYIYEESFN
IHHLEMNVEHLVEKMKTTVKRGLILRNEKCNANYTTDFIFNLYSEEGKGIFDCRKNVLGH
MQQGGTPSPFDRNFGTKMGIKSVLWLTDKLKECYRHGRIFANSQDSACVLGMRKRALVFQ
PLAELKDETDFEHRIPKKQWWLKLRPILKILAKYKINLDISEKAAMEHVIKRRSVVP
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcaggctcccattgaccccaccaagataggtgagggtcgagccattgctgtt
ctgacctccggaggcgatgcccaggggatgaatgcagctgtgagagccacagttcgagtg
ggactgtacactggagccaaggtttattttgtccatgagggttatcagggtctggtggat
ggaggagaccacattcgccctgccacttgggagagtgtgtcaatgatgctgcagctgggt
gggactgtgatcggcagtgcccgttgtcaagatttccgctccaaggagggccgcacaaag
gcggcttataacttggtaaagctgggcatcaccaacttgtgcgttattggaggggacggc
agtctgacaggtgccaaccagttccggacagagtggaaagatctattagcagatctaata
aaagctggaaaaattacagcaaatgaggcaaaaaattcctcccacctcaatattgttggt
atggtgggctccattgataatgacttttgtggaactgacatgaccattggcactgactcc
gccctccatcgcatcatcgagatagtggacgccatcactaccacagcacagagtcaccag
aggacctttattctggaagttatgggacggcattgtggctaccttgctttggtgacagct
cttgcctgtggagctgactgggtgtttatcccagagatgccacctgaagaaggatgggag
gatcatttatgcagaaggctgacagagcaacgaggccggggctctcggttgaatatcatt
attgttgcagagggggcaatagatcgccatggaaaaccaattacctgtgacctagtcaaa
cagctggtatccaagaagctcggctttgacacccgcaccaccattctgggacatgtgcag
agaggaggaacgccctccgcttttgaccgaatcttggctagcaggatgggtgtggaggct
gttatggccctactggaagccacgcctgataccccagcctgtgtggtcagcttgtctgga
aacatggctgttaggctgcctcttatggagtgtgtgcaagtgactaaggatgtcatgaca
gccatggctgaaggccggtttgatgaagcagtgaatctcaggggaaagagttttgagaat
aactggaatacctataaaatgcttgcccatgtccacccaccagagacaaaaagtaacatc
aatattgccatattaaacgtaggcgccccatgtgcaggaatgaacgctgccgtccgtgca
gctgtcaggatcgggctcctccagggccatcagatgctggcagtgcatgatagctttgat
ggcttggctcatgggatgattgagcccattacttggtcaggagtggcaggatggactgga
aagggcggctccatactaggcacaaaaagatctttaccacatgagttcatggaggaaatc
agtctaagcattaccaagttcaacattcatggtcttgttatcattggaggctttgaggcg
ttcctgggaggtctagagatggtgcaagcaagagagaagtatgaggagctctgcattcca
cttgtggttgttcctgctactgtgtccaacaacgtcccaggaactgacttcagcattggt
gctgacactgccctcaacacaattaccatgacatgtgataggatcaagcagtccgctgct
ggcaccaaaagaagagtgttcatcgtggagactatgggaggattctgtggttacctggca
accatggcgggtttagcatctggagctgatgctgcctacatttatgaagagtctttcaac
attcatcaccttgagatgaatgtagaacatcttgttgagaagatgaagacaacagtgaag
agaggactcattctcagaaatgagaaatgcaatgcaaactacaccaccgactttatcttc
aacctttattctgaggagggaaagggaatttttgactgcaggaaaaatgttcttggccac
atgcagcagggtggtacaccgagtccctttgacaggaatttcggcacaaagatgggaatc
aagtctgtcctttggttgactgacaagctgaaagaatgctacagacatggtcgcatcttt
gccaactctcaggactcagcctgtgtgctgggtatgaggaagagagctttggttttccag
cctttggcagaactcaaagatgaaactgactttgaacatcgtattccaaagaaacagtgg
tggttaaaactgaggcccatcctgaaaatcctggctaagtacaagatcaacctggatatt
tctgaaaaggctgcaatggaacatgtcatcaaaaggagaagtgtagttccctaa

DBGET integrated database retrieval system