KEGG   Oryzias latipes (Japanese medaka): 101174595Help
Entry
101174595         CDS       T02443                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04210  Apoptosis
ola04625  C-type lectin receptor signaling pathway
ola04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101174595
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101174595
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101174595
   04672 Intestinal immune network for IgA production
    101174595
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101174595
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101174595
Protein kinases [BR:ola01001]
 Serine/threonine kinases: STE group
  Other
   101174595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101174595
NCBI-ProteinID: XP_011476291
UniProt: H2LIB5
LinkDB All DBs
Position
8
AA seq 866 aa AA seqDB search
MAVRQRFFNSTAPFSDSPKELKGTCPSYSSVEQETEDEEEEGKDNTKGYVDVAEWAANPF
FNKLLTQGTAEQVGEKPIKTSTIIAQAECETQDSQEFSPSCYERSFVPSPNCFTSSLSCE
HNNVACPTTASYQEQSGFSSNFSPRKKSRRRQKRKGAKKKERRTDNQRQRRRTPSGVPEQ
ESGSSQAQILESLSHGESSDLSSSCCSSSTESLETQERRASLYPLLICDTGSSCSPLNWP
QSFCRPFSRPLSYEQENSSDSLSSVGDCSLALAGLRGSVSQGDPCFAGPFFKDVERELTE
EEDELSASSVIKNEGIIFYNDKIQPVDSEYKEGSEYTLTHFIKQGSYGEVRCAQDVKTGF
KFAVKKIALRRFISEEVGAWSALRSPRVVELFGVIRDGPNIVLLMDLKSGCLGDLIKRCG
RLPEDLSLHYHSQVLAALEYLVKKRVAHLDIKADNVLLSEDGRDSYLCDFGHAEKVDHQG
QSLSGFKDLKGTESHMAPEIVKGEPRGTKADVWSSCCMLLHMLNGCQPWTRYYTCRLYLK
IANEPPPLREIPGDCSPLTADVLKAGLQKDPVKRLSASDLKLKTDSALKQVGGLTSVVEG
PYTTPLHVQDKLLDSQQLLHSSADFEADETQLSVNKVISAGLRTKKPDDEEDVESNKSFS
NAPQMLIHEPNYKNYHEEITVPELELRKLERDLYLSSLSQLHSAEMQEQLLSCLNSDHCF
NREPWDKKDSGRWSLSPGDDPSSGFFSSNSQPEVQPFSIGLLGQFEFPLPSCLEGVDVHI
RDFSCKTIRIREKRRVKVGHIATGISDQISERVFTLETAHGRQVPHNEEVQESGLELRCV
PAPDFSRAWSWRIKDGLLETRESPQV
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgaggcaaaggttcttcaactccacagctccgttctctgactcacccaaagag
ctgaaggggacatgtccatcttactccagcgtggagcaggagacggaggatgaggaagag
gaggggaaggacaacacaaaaggctacgtggatgtagctgaatgggcagccaaccctttt
tttaataaactcctgacacaagggactgcagagcaagtgggagaaaagccgataaagacc
tcaaccatcattgcccaggctgaatgtgaaacccaggactctcaggagttcagcccctca
tgttatgaacgctcttttgttccctcccctaactgctttaccagcagtctttcctgtgag
cacaataatgttgcgtgccccacaacggcctcctaccaggagcagagcggcttttcatca
aacttctccccaagaaaaaagagtcgcaggaggcagaagcgaaaaggggcaaagaaaaag
gagaggaggacagacaaccagcgacaacgccgacgaacgccatcaggagtccctgagcaa
gagagcggaagctctcaagctcagatcttggagtccttgtctcatggagagagcagtgac
ctcagcagctcctgctgcagcagcagcactgagagcctggagacgcaggagcgaagggct
tctctttacccgctgctgatttgtgacacgggctccagctgctcccctttaaactggccc
cagtcgttctgtcgccccttctccaggcctttgtcctatgagcaggaaaacagctcggac
tccctcagcagtgtgggagactgttccctggccctcgctggactccggggcagcgtcagt
cagggggacccatgcttcgctgggccctttttcaaagacgtggagagggagttgacagag
gaggaagacgagctgtctgcgtcttctgtcataaaaaatgagggaataatattttataac
gataaaattcaacccgtagattctgaatacaaggaagggagcgagtacaccctgacacat
ttcatcaaacagggctcctatggagaagtccgctgtgctcaagatgtcaaaacaggattc
aaatttgctgtgaaaaagattgccctgaggaggttcatcagcgaggaggtgggtgcgtgg
agtgccctcaggtctcctcgtgtggtggaactctttggagtgatcagagatgggcccaac
atcgttcttttaatggacctcaaaagtggctgcctgggtgacctgatcaagaggtgcggc
cggctgccggaggatttgagtctgcattaccactcacaagtgctggcagcacttgagtac
ttggtcaagaaaagagtagcacatttagatattaaagccgacaacgtgttgctgtcagaa
gatggtagagactcctacttgtgtgactttggacatgcagagaaagtggaccaccagggc
cagagccttagtgggttcaaagacctgaagggcacagaaagccacatggcacctgagatt
gtgaaaggagaaccccgcggaaccaaagcagatgtgtggagcagctgctgtatgttattg
cacatgctcaacggttgccagccatggacgagatactacacctgcaggctctaccttaag
attgcaaatgagcctccacctctgagagagatccccggtgactgtagtcctctcacagct
gatgttttgaaagcaggcctccagaaggatccagttaagaggttgtctgcatctgacctc
aaacttaaaactgacagcgctctaaaacaagtgggaggactcaccagtgtagtggaaggg
ccctacactacacctctgcatgttcaggacaaactgctggactcccagcagctgcttcac
agcagcgcagactttgaggccgatgagacgcagctctccgtcaacaaggtgatctccgcg
ggtctgaggacaaagaaacctgacgacgaggaagacgtggagtccaacaagtccttctct
aacgctccacaaatgctcatccatgagccaaactataagaattaccacgaggaaatcaca
gtgcctgaactggagcttcgtaaactggagcgggacttgtacctgagcagcctctcacag
cttcactctgcagagatgcaggagcagctcctctcttgtctcaacagtgaccattgtttc
aaccgggagccgtgggataaaaaggactctggccgctggtctttgagcccaggagatgac
cccagctccggcttcttctcctccaacagccagccagaggttcagcccttcagcatcggt
ttgctgggtcagttcgagtttccgctgcccagctgtcttgaaggggtggacgtccacatc
cgagacttcagctgcaaaaccattcggatcagagagaagcggcgggtgaaggttggccac
attgccactggaatcagtgaccagatctctgagcgggtgttcactctggagacggcgcac
ggccggcaggtccctcacaacgaggaggtacaagaatctggtctagagctccgctgtgtc
cccgctccagacttcagtcgcgcgtggtcgtggaggatcaaagacggactcctggagacg
cgtgaaagcccacaagtctga

DBGET integrated database retrieval system