KEGG   Oryzias latipes (Japanese medaka): 101174634
Entry
101174634         CDS       T02443                                 

Gene name
mdm2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04068  FoxO signaling pathway
ola04110  Cell cycle
ola04115  p53 signaling pathway
ola04120  Ubiquitin mediated proteolysis
ola04144  Endocytosis
ola04218  Cellular senescence
ola04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ola00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101174634 (mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101174634 (mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101174634 (mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    101174634 (mdm2)
   04115 p53 signaling pathway
    101174634 (mdm2)
   04218 Cellular senescence
    101174634 (mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101174634 (mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ola04131]
    101174634 (mdm2)
   04121 Ubiquitin system [BR:ola04121]
    101174634 (mdm2)
Enzymes [BR:ola01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101174634 (mdm2)
Membrane trafficking [BR:ola04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    101174634 (mdm2)
Ubiquitin system [BR:ola04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    101174634 (mdm2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 101174634
NCBI-ProteinID: XP_004083278
UniProt: H2MRU0
LinkDB
Position
23
AA seq 498 aa
MSADREINTDATNENNLVRPKVEFCSLLQHAGATKDVFTMKEVMFYLGRYIMQKQLYDQK
QQHMVHCAQDALGRVLGVDSFSVKEPRVLFAMITKNLVAVNNKDSASDSGESASSRPDRG
SEVAETEGRSSSLDRRRRRRRSHRSSDPGPSQSVEEEDEAEEEEEGEGRKRRRSDSYSLT
FDDSLSWCVIGGLVSGRDRQSSQSSSSESTSERSEVTAAPSESDSDNFSVEFEVESIDSD
DYGEDDASLSADDQVYEVTIFEADDEDSFDEDTEITEADYWRCSKCDELNPPLPRNCLRC
WDLRQDWLPNQSANAASSPKALPTKPNNQSDAKDAPGCDVEDAEGVDVPDGKRTKSSPSS
QSQSDYSCSAPNSQDLLSLSQPSSSSSQEKLWTPESQPCSSSLSSDVNELLPSSPTAPPP
PQCLPELERSVSAEWRLPDSCLDPCLICQSRPKNGCIVHGRTGHLMSCYVCARKLKKRNK
LCPVCRMPIQSVVLTYLS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtcagctgacagggagatcaacacagacgctacaaatgaaaacaatctggtcagacca
aaggtagaattctgctccttgctgcaacacgccggagccactaaagatgtcttcaccatg
aaggaggtgatgttctacctcggtcggtacatcatgcagaagcagctgtacgaccagaag
cagcagcacatggtgcactgcgctcaggacgctctgggccgggttctgggagtcgacagc
ttctccgtgaaagaaccgcgagttctgtttgcaatgatcaccaagaacctggtggctgta
aataacaaagattctgcctcagactctggtgaatcggcgagcagccggccggaccgcggc
tccgaggttgcagagacagagggccgctcttcatcacttgacaggaggaggaggagaagg
aggagccacagaagcagcgatccagggccgtctcagagcgtggaggaggaggatgaagca
gaggaggaggaggagggggaaggcaggaagaggagaaggtctgacagctactccctgacc
ttcgatgacagcctgtcttggtgcgtgattggagggctggtgagtgggcgggacagacaa
agcagccaatcctcgagctcggagagcacgtcggaaaggtcggaggtcacggcagcgcct
tcagagtcggacagcgacaacttcagcgtggagttcgaggtggagtccatcgattctgac
gactatggcgaagacgacgcgtctctgtcagcagatgatcaggtgtacgaggtcaccatc
tttgaggccgacgatgaagactcctttgatgaagacaccgagatcacagaggctgattac
tggaggtgttcaaagtgtgacgaattgaacccccccctgcccagaaactgtctccgctgc
tgggatctgcgtcaggattggctgcctaaccagtccgccaacgccgcctccagccccaaa
gcgcttcctaccaagccaaacaaccaatcagacgccaaagacgctccaggttgtgatgtg
gaggacgctgaaggagtcgacgttccagatggaaaaagaacgaaaagctctccttcctca
cagagtcagtcggactacagctgctctgctccaaactcccaggatctcctctcactgtca
cagccctcctcctcctcctcgcaggagaagctctggactccagagtcgcagccctgctct
tcctcactatcttcagacgtcaacgagctcctcccctcttcgcctacagctcctcctccc
cctcagtgcctccccgagctggagcgcagcgtgtcggcagagtggcgcctgccggactcc
tgcctggacccgtgcctcatctgtcagtcgcggcccaaaaacggctgcatcgtccacgga
cggacgggtcacctgatgtcctgctacgtctgcgcccgcaagctgaagaagaggaacaag
ctgtgtccggtctgcaggatgcccatccagtccgtggtcctcacctacctgagctga

DBGET integrated database retrieval system