KEGG   Oryzias latipes (Japanese medaka): 101174785
Entry
101174785         CDS       T02443                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04060  Cytokine-cytokine receptor interaction
ola04068  FoxO signaling pathway
ola04144  Endocytosis
ola04218  Cellular senescence
ola04350  TGF-beta signaling pathway
ola04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101174785
   04350 TGF-beta signaling pathway
    101174785
   04068 FoxO signaling pathway
    101174785
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101174785
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101174785
  09143 Cell growth and death
   04218 Cellular senescence
    101174785
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101174785
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ola01001]
    101174785
Enzymes [BR:ola01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     101174785
Protein kinases [BR:ola01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   101174785
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Choline_kinase
Other DBs
NCBI-GeneID: 101174785
NCBI-ProteinID: XP_004081706
LinkDB
Position
21
AA seq 564 aa
MTRSGTAAFVAACSLLVVVEPFGSLRANVCKWCLPSTPVCKDNICLSNCNLSSYCSFTEE
ICIAIWRKTNETMTVHTMCHHPNLPLEGINPRLLLNFTSRECHMLPQPADEGVMMVCGCQ
GEQECNDKLIFDKGVSGFSRLHSKDVIPVVIVSLVPPLLVAMVATAVFYSYRMRRPDKPG
PASRSDWPTKRSPELYQVLDHPRGEAGGGVVVLGVEPVINNTKGRCPNKITVGKRIAELL
PIKLEDVVGRGRFAEVWRARLLQSDMGGVNSYETVAVKVFPNVEYASWRNECSILSDPTL
QHENLVQFLAAEERSLPSDTLRTYWIVLAHYSLGNMQDHLTANTLSWEELVSLASSIANG
LAHLHSETKLNGAPKVPVAHRDLKSSNILIKNRKQCVLCDFGLALRLDISLTVDDYANSG
QVGTARYMAPEVLESRVNLEDLEAFKQMDIYSMALVLWEMASRCDVIEEVKAYQPAFGSK
VCEQPCVDSMRDLVLRDRGRPDIPSAWTQHQGMSVFCSTITECWDHDPEARLTAHCVVER
FNAMQHSEEEAVLEDGGLGGGRQE
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgacgcggagcggaaccgcggctttcgtcgccgcttgcagtctcctggttgttgtcgag
cccttcggcagcctaagagccaacgtgtgtaaatggtgtttaccatccactccagtttgc
aaagacaacatctgcctcagcaactgtaacctgtcctcctactgttccttcacagaggag
atctgcatcgccatatggaggaagaccaatgaaacgatgacagtgcacacgatgtgtcac
catccgaatctgccgctggaaggcatcaaccctcgcctgttattgaattttacctccaga
gagtgtcacatgctcccacagccggcagatgagggtgtgatgatggtctgtggctgtcag
ggcgaacaggaatgcaacgacaaactcatctttgacaagggagtcagtggtttctccagg
ctgcacagtaaagatgtgatcccggtggtcatcgtcagcttggtgcctcctcttctggtt
gccatggtcgccactgctgtcttctactcctacagaatgcgccggcctgacaaaccaggg
cctgcttctcgatctgattggcccacaaagcgctcccctgaactctaccaagttttggat
catccacgtggagaagcaggaggtggtgtggtggttcttggagttgaaccagtgatcaat
aacaccaaaggcagatgtccaaataaaatcaccgtcggtaagaggatagctgagctgctc
cccatcaagctggaggacgtggtgggcagggggcgctttgctgaggtctggagggctcgc
ctgctgcagagcgacatgggtggagttaacagttacgaaactgtggcagtaaaggtgttt
cccaatgtggagtatgcctcatggagaaatgagtgctccatcctatctgaccctacactt
caacacgaaaacttggttcagttcctggcagctgaagaaagaagcctgccaagcgacact
ctcaggacttactggatagttttggcccattacagccttggaaatatgcaggaccacctc
acagcaaatactctaagctgggaggagcttgtttccttagcaagtagcatagctaacggg
ttagctcacttacacagtgaaacaaagctgaatggagcaccaaaggttcctgttgctcac
agagacctgaagagtagcaacattttgataaagaacaggaagcagtgtgtgctgtgtgac
tttggtctggcattaaggctggacatctccctcacagttgatgactacgccaacagcgga
caggtgggaacagctcgttacatggctcctgaggtgctggagtccagggtgaacctggag
gacctggaagctttcaaacagatggatatctactccatggctctggtcctttgggagatg
gcctcccgctgtgatgttattgaagaggtgaaggcctaccagccggcttttggctccaag
gtctgtgagcagccctgtgtggacagcatgagggacctggtgctgagggaccgaggacga
cctgacatcccctcagcatggacgcagcaccaggggatgagtgtcttctgctccaccatc
actgagtgctgggatcacgacccggaggcaaggctgacggcccactgcgtggtggagcga
ttcaacgccatgcagcacagtgaggaggaggcggtgctcgaggacggtgggctgggggga
ggacgacaagagtga

DBGET integrated database retrieval system