KEGG   Oryzias latipes (Japanese medaka): 101175300
Entry
101175300         CDS       T02443                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101175300 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    101175300 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    101175300 (kitlg)
Cytokines and growth factors [BR:ola04052]
 Growth factors
  Growth factors (RTK binding)
   101175300 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 101175300
NCBI-ProteinID: XP_011471186
LinkDB
Position
6
AA seq 252 aa
MKKSKSWIRVCVRFLLLITLGVPSCTFGSFQITDDISKLSVLKQNIPRDYNISVRYIPKE
LAGMCWVKLNIFFMEESLNELAKKFGNVSSNKNDIKIFIDMLQYMRLPLGNLEPLMYDFE
CHFRNEQWQTEQYFDYVKDLLKAAEDNISDDCDPPPCPTSLPTETFSTYSICTGCSPRTA
TYYGTPEKLLQSLPILFIPLLALVFLLVWKLQSKRNEEISQQYPLDGLFTRTEGTQPPQD
EASETLNITETV
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaagttggatacgcgtctgtgtccgtttcctgctgcttatcacgctt
ggggtaccttcatgtacttttggttccttccaaatcacagatgacatctcaaaactttct
gttttgaaacaaaatattccaagagattataatatttctgtgcgctacattccaaaagaa
ctggcagggatgtgttgggtaaaattaaacatcttttttatggaggaaagtttaaacgaa
ctggcaaaaaaatttggaaatgtttcatccaataaaaatgacattaaaatattcattgac
atgcttcaatatatgcgattgccactaggtaatctggaaccattaatgtatgactttgag
tgccacttcagaaatgagcagtggcaaacagagcaatactttgactatgtcaaagacctc
ctcaaagctgcagaagacaacatttcagatgactgtgatccccccccctgtcctaccagt
cttcctacagagacattctctacctacagtatatgcacaggatgttctccccggacagca
acgtactatggtactcctgagaagttgctacaaagccttcccatactctttattcccctt
cttgcccttgttttcctgctggtgtggaagctccaatcaaaaaggaacgaggagatttct
caacagtaccctttagatggactcttcactagaacagaagggacacaacctcctcaagat
gaagcatctgaaacactgaacatcactgaaacagtgtaa

DBGET integrated database retrieval system