KEGG   Oryzias latipes (Japanese medaka): 105355856
Entry
105355856         CDS       T02443                                 

Gene name
adcy3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00230  Purine metabolism
ola01100  Metabolic pathways
ola04020  Calcium signaling pathway
ola04114  Oocyte meiosis
ola04261  Adrenergic signaling in cardiomyocytes
ola04270  Vascular smooth muscle contraction
ola04371  Apelin signaling pathway
ola04540  Gap junction
ola04912  GnRH signaling pathway
ola04914  Progesterone-mediated oocyte maturation
ola04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    105355856 (adcy3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105355856 (adcy3)
   04020 Calcium signaling pathway
    105355856 (adcy3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    105355856 (adcy3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    105355856 (adcy3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    105355856 (adcy3)
   04914 Progesterone-mediated oocyte maturation
    105355856 (adcy3)
   04916 Melanogenesis
    105355856 (adcy3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    105355856 (adcy3)
   04270 Vascular smooth muscle contraction
    105355856 (adcy3)
Enzymes [BR:ola01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     105355856 (adcy3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA OPA3
Other DBs
NCBI-GeneID: 105355856
NCBI-ProteinID: XP_023819712
LinkDB
Position
16
AA seq 1119 aa
MPRNQAFAEPEYSAEYSADYSVTLPSDPGQAVGRTHEVTVRSSGCCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDSYVIVMCAVVYTSDKLASVLVASAGLAGDII
LYLLCRFGLLPDRISRRVVPYALWVLIAAQVFCHLGLNYAHFHQASDTVGWQAFFSFSFF
LTLPLRLTPIVLITTVSCGVHTLVLGVTIAQQQQDNIQGAALGRQLLANAFIYVCAITVG
VMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLLLSILPKHIADEMLQDMKKEPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAACSIMMGLAMVEAISYVREKTQTDVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQTTMECLHGEFDVEPGNGGERCD
YLRERGIDTYLVVVPKGAVGKNGISGVKLSVTSSGGNSPQLINTTECNGSANTACTTPEE
PEELDTKVVNPSFPNPRRRLRLRDLAERVIDAQENEAELNKLLNEALLERETVQALKGKN
TNRLSLRFVDPELETRYSVEKEKQSGAAFCCSCVVLLCTTFMEALLDPWMIANYVTFAVG
EVLLLILTVCSLAAIFPRVYPKKLVTFSTWIDHTRWARNTWAMAAIFILSTADTIDMLSC
GPPESDPRSTTPPPSSSGRSSLEGCWNNPKYYSYVAVLALMATTMLVQVSHMVKLTLMLL
ITVTTGAVNIYSWRSIFDRYDAVRFKEYRSALVPSKVSVTVMIFVMMISFYYFSRHVEKL
ARTLFLWKIEVHEQKEKVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIG
VMFASIPNFSDFYTEESINNGGIECLRFLNEIISDFDSLLDEIQFRCITKIKTIGSTYMA
ASGVTPDVTNGYNCVKKEEQSDRERWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGL
NKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEDCYNILKEYGFRFVKRG
PIFVKGKGELLTYFLKGRDKQGSFINGSSVTLPHQVVDS
NT seq 3360 nt   +upstreamnt  +downstreamnt
atgcctcggaaccaagcttttgcggaaccagagtactctgcagagtactctgcggactac
tccgtgaccctgccctctgacccggggcaggctgtggggcgaacacatgaggtaaccgtg
cgaagctcaggatgctgcctctgccttcctcgcttcatgcgcctaacctttgcgccagag
tccctggagaatttgtaccagacctacttcagacggcagcgacacgagactctgctggtg
ctggtggtgtttgccgccctctttgactcctatgtcatcgtcatgtgtgcagtggtctac
acctcagacaagctggcctctgtcttggtggcgtcggctggacttgcaggggacatcatc
ctctatctgctgtgtcgttttgggcttctcccggaccgcatctccagacgggtggtgccc
tacgcattgtgggtgctcatagcggctcaggtgttctgccacctgggtctgaactacgcc
cacttccaccaggccagtgacacggtgggctggcaggccttctttagcttctcattcttc
ctgactctgcctctgaggctgacccccattgtgctcatcaccactgtgtcgtgcggcgtc
cacaccctggtcttgggggtcaccattgctcagcagcagcaggacaacatccagggagca
gctcttggaagacagctcctggccaacgccttcatctatgtatgtgccatcaccgtgggt
gtcatgtcctactacatggctgaccggaagcatcgaaaagcttttctcgaggccagacag
tctctggaagtgaagctgaacctggaggagcagagccagcagcaggaacgtctacttctc
tcaatccttccaaagcacattgcagatgagatgcttcaggacatgaagaaggagccgagt
caaaaggagatgcagcagtttaacaccatgtacatgtacaggcacgagaatgtcagcatc
ctgtttgcagacattgttggcttcacccagttatcgtcgtcctgcagcgcccaggagttg
gtcaaactgctgaatgagctcttcgcccgctttgacaagctagctgcaaaatatcaccag
ctgagaatcaagatcttgggagactgttactactgcatctgcgggcttccagactacagg
gaggaccacgccgcctgctccatcatgatgggcctggcaatggtggaggccatatcgtat
gttcgtgagaagacccagaccgacgtggacatgagggtcggggtgcacagtgggaccgtg
ctggggggcgtgctggggcagaagcgctggcagtatgatgtgtggtctacagacgtcact
gtggccaacaagatggaggctgggggcattccaggccgtgttcacatctctcaaaccacc
atggagtgtcttcacggcgagtttgacgtggagcctgggaacggcggcgagcgctgcgac
tacctgagggagagaggcattgacacctacctggtggttgttcccaaaggggcggtggga
aagaatggcatcagtggtgtgaagctgtctgtgacgtcttctggaggaaactccccacag
ctcatcaacaccacagaatgcaacggcagcgcaaacacagcctgcaccacgccagaggaa
ccagaggagctggacaccaaggtggtgaatccgtctttcccaaaccctcggaggaggctg
agactgcgggacctggctgaacgagtaattgatgctcaggaaaatgaagcagagctcaac
aaacttctaaacgaagctttgctggagagagagacggtccaggcgctgaaggggaagaac
accaaccggctgtcgctgaggtttgtggacccagagcttgagacccgctactctgtggag
aaggagaagcagagcggagctgccttctgctgctcctgtgtggttctgctctgcactact
ttcatggaggctctccttgacccatggatgatcgccaactatgtcacgtttgcagtgggg
gaggttctgctgctcatcctgaccgtctgctcacttgctgccatcttccctcgagtatat
cccaagaagctagtgactttctccacctggattgaccacacccgctgggctcgaaacacc
tgggctatggcggccatcttcatcctcagcacggctgacaccattgacatgctgagctgt
ggacctccagaatcagatcctcgcagcaccacgccgcctccctcctcctctggacgctcc
agcctggaaggctgctggaacaatcctaaatactacagctatgtggcggttctggctctg
atggccaccaccatgctggttcaggtcagccacatggtcaagctcaccctgatgctgctg
atcacagtgacgacgggcgctgtgaacatctacagctggaggagcatcttcgaccgctac
gatgccgtccgctttaaggagtacaggtcggccctggttccctccaaagtcagtgttaca
gttatgatcttcgtcatgatgatcagcttctattatttttccagacatgtggagaagcta
gctcgcactcttttcctgtggaagattgaggtccacgagcagaaggagaaggtttacgaa
atgcggcgctggaacgaagcccttgtgaccaacatgctgccggagcacgtggctcgacac
ttcctgggctccaagaagagggatgaggagctgtacagccaatcctatgatgaaattgga
gtcatgttcgcctcgatcccaaacttttctgacttctacaccgaggagagcatcaacaac
ggaggcatcgagtgcttacgcttcctgaacgagatcatctcagactttgacagcttgctg
gatgagattcagtttcgctgtatcacaaagatcaagactattggtagcacctacatggca
gcatcaggagtgacgccagacgtcaccaacggctacaactgtgtgaagaaggaggagcag
tctgacagggagcgctggcagcaccttgcagacctggcagactttgccctggccatgaag
gtcacgctcatgaacatcaactaccagtcgttcaataacttcatgctgcgcataggtctg
aataagggaggagtgctggcaggggtgatcggcgcacgcaaacctcactacgacatctgg
ggcaacaccgtgaatgttgcaagccgcatggagtctacgggggtgatgggcaacatccag
gtggtggaggactgctacaacatcctgaaggaatacggcttccgcttcgtgaagagagga
cccatctttgtgaaaggcaaaggggagctgctcacctacttcctcaaaggaagggacaag
cagggctccttcatcaacggctcctcagtcaccctgcctcaccaggtggtggacagctga

DBGET integrated database retrieval system