KEGG   Oryzias latipes (Japanese medaka): 105357082
Entry
105357082         CDS       T02443                                 

Definition
(RefSeq) uncharacterized protein LOC105357082
  KO
K05461  KIT ligand
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola04010  MAPK signaling pathway
ola04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ola00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105357082
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    105357082
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ola04052]
    105357082
Cytokines and growth factors [BR:ola04052]
 Growth factors
  Growth factors (RTK binding)
   105357082
SSDB
Motif
Pfam: SCF DUF2771
Other DBs
NCBI-GeneID: 105357082
NCBI-ProteinID: XP_023808347
LinkDB
Position
23
AA seq 245 aa
MRKKILQATWFLLSLLLSLKLSCGKFGAPITDDVNKLSVLKQNIPSDYEIPVSYIPKEVA
GTCWVVLNIYPLEQSLRKLSTMFGAISSNKDTITVFIAMLKSLRFTFDHEELETVMQVFQ
CHYQEQSLQSSLYFDHIRDVLRAAAQGSSGFSCKPPPCRNHQQGQEKSRGHSWLMRSPLL
LVLIPFTTCVVLIVWQVKCRRRLPAANTANGQMVTPDMIPTLSVSIPLETLTHAADTQPN
GGGDR
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaggaagaaaatcttgcaagctacttggttcctcttgagtttgttattgagtttgaaa
ctctcctgtggaaaatttggagcaccaattactgatgatgtgaacaagctgtcagttttg
aagcagaatattccctctgattatgagattccggttagttacattcccaaagaagtggcc
ggcacgtgctgggtggtgttaaatatctaccctttggagcaaagtcttcgaaagttaagc
accatgtttggtgccatctcctccaacaaggacaccataacagtctttattgcaatgctc
aagagtttacgtttcacctttgatcatgaggagctggaaactgtgatgcaggtcttccag
tgtcactatcaggaacagagtttacagtcaagtctttactttgaccacatcagagatgtt
ttacgtgctgcagctcaaggatcatcaggcttctcatgtaaaccaccaccatgccgtaat
catcaacagggtcaggaaaagagtcgtggacacagctggctcatgagaagtcccctgctt
ttggtgctcatccctttcacaacctgtgtagttctcatagtgtggcaggtcaagtgcagg
aggagattaccagctgccaacactgcaaatggccaaatggtaactccagacatgatccca
actctgtctgtctctattccacttgaaacactcacccacgccgctgacactcagccaaac
gggggaggagatcgctga

DBGET integrated database retrieval system