KEGG   Oryzias latipes (Japanese medaka): 111948936Help
Entry
111948936         CDS       T02443                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ola  Oryzias latipes (Japanese medaka)
Pathway
ola00020  Citrate cycle (TCA cycle)
ola00190  Oxidative phosphorylation
ola01100  Metabolic pathways
ola01200  Carbon metabolism
Module
ola_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ola_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ola_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ola00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111948936
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111948936
Enzymes [BR:ola01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111948936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Thi4
Motif
Other DBs
NCBI-GeneID: 111948936
NCBI-ProteinID: XP_023819889
LinkDB All DBs
Position
16
AA seq 199 aa AA seqDB search
MPLSGTQWSTYVTAYYRNSVEYNREITDFKITRALVFRKHQAGWKNVVSRSITIEIREGR
GVGPEKDHVYLQLHHLPPQQLAARLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPT
NYKGQVIDYTDGKDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIASEH
KPGKLCSLFTVYLILSLHE
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccactatctggcactcagtggtcaacatacgttactgcatactatcgcaacagtgtt
gaatacaatagagaaattactgatttcaagatcaccagagctctcgtattcagaaaacat
caggcaggttggaaaaacgtggtgtcccgctccattaccatagagatcagggagggcagg
ggtgtcggtccagagaaggaccacgtgtacttgcagcttcatcatctgcctcctcagcag
ctggccgcaaggctgcccgggatctcggagacggcaatgatctttgctggagttgacgtc
accaaagaacccatccccgtcctgcccacagtccactacaacatgggaggaatccccaca
aactacaaaggacaggtaatcgattacacagatggtaaggacaaagtggtgcctggactt
tacgcctgcggtgaggcagcttgtgcgagcgtccatggggccaacaggctgggtgctaac
tccctgctggacttggttgtcttcgggagagcctgtgccctcactatagctagtgagcac
aaacctggtaagctctgttcactgttcacggtttatttaattctttcattgcacgaatag

DBGET integrated database retrieval system